SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003070 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003070
Domain Number 1 Region: 178-306,362-497
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.81e-27
Family Transglutaminase core 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003070
Sequence length 738
Comment protein Name="PYU1_T003070" Note="Similar to Xpc: DNA repair protein complementing XP-C cells homolog (Mus musculus)" AED:0.102841677943166 QI:0|-1|0|1|-1|1|1|0|738
Sequence
MSSSNGDSDGEQVQWEDASGGAGAAVVGSADKEEADEGEDEEEFMYSDDSADEDDVDWED
VGESKAASATQQPLMPTVPSPLSHVQEDGEDDEKEEQFDDDDNDDDETYDYEEDAAMEDD
DDEDDEQQRQTLTDLQKVDWDQVNKVLAKEAAEASKQTKKRKIQRMSKADKERELVLHQS
HLLLLLATQLKWNALCESPVLRGLLLSLACDSPFDFYTEMRNQPMKYSLELLVRWFREHF
RVVEDTGDVDDDDLQAPDENGGEVLTEAKLMEVFFEKQGREHELAVLFTALCRSLRLRCR
HTSALDALLIQQSKAFESSLSASRSPINRRRTRKRSRSNATVTKGDAGDAFTVEAAVSTQ
SYWIWSEVYDDKKKAWISVDTIRRLVGRPQDIEPLRKGALFSYIVSISGSERLIDVTPRY
AARWSKTLKLRIADTWWGLTIDAMSAEALNRTNCSNQLYDIDEREEEERIFVQEKSQLTA
MTESEEMPTSLEGFKKHHLYCLERHLGRFDCIYPRKAVGIFKGQPVFLRKHVHVTRSAYQ
WRRLGREINDSEREKPAKWYKTFSKSNNGAGDSGDDDDDDGGGMSQTNRGNGARAMFGVW
QTSVFVSPPVVDGIVPKNSYGNIELWSKAHVPRHAVHVQLPRIEKVAQQLGIDFAPAVVG
FEVKDGRNVPKFDGIVVAESSFEVLVDAHAHIQQSTIEKAIEKNQQLVTKRWERIVKRLL
LRQRLEDDYGAIGSSSSS
Download sequence
Identical sequences K3WDM9
PYU1_T003070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]