SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003107 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003107
Domain Number 1 Region: 28-169
Classification Level Classification E-value
Superfamily Bet v1-like 0.00000655
Family AHSA1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003107
Sequence length 175
Comment protein Name="PYU1_T003107" Note="Protein of unknown function" AED:0.316666666666667 QI:0|-1|0|1|-1|1|1|0|175
Sequence
MVSTVGLKHADAVGAQEFDAAAAANAFALEQVVPAPVEQVFDAYLKRIWLGKFKITAPGE
GRGLVGNERFIAAFGVTEKILRAGVPAPDNAQIASITYAVTTFGKFPWTYHLGFVQFVPS
ADGKATTVVVGSKTTPKNKADGTPIDDSKLRDVLKKGITAQLAALAKSYSADSKL
Download sequence
Identical sequences K3WDR6
PYU1_T003107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]