SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003108 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003108
Domain Number 1 Region: 40-94
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000254
Family Myb/SANT domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003108
Sequence length 272
Comment protein Name="PYU1_T003108" Note="Similar to mybJ: Myb-like protein J (Dictyostelium discoideum)" AED:0.131735158022712 QI:0|-1|0|1|-1|1|1|0|272
Sequence
MTISRTVYNQLFEHSDAAAEHVIRLRPTEAKAGAVVVSAKNKIQMWTQEEHERFLVALEM
FPAGPWKKVADYIGTKTPRQTMTHAQKYRQKISRRQRGLRNQKKNSSAPNSPKHLDTQSD
YKHAPMPVHSPYGVADVYVKSEAKMYPQADVNSSGRLDMLARAMQMQSEAKPSNHGYYAQ
QQQPAPTQQVEMNAQEGSFIMPSRGVPTAPATSAAASSPGNSSLPSLAQILNLRGAPQAP
QPQAATRPGCNCNCSCSPSSKGQDNCRESALK
Download sequence
Identical sequences K3WDR7
PYU1_T003108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]