SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003197 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T003197
Domain Number - Region: 17-109
Classification Level Classification E-value
Superfamily Histone-fold 0.0112
Family Nucleosome core histones 0.035
Further Details:      
 
Domain Number - Region: 292-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0964
Family Ubiquitin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003197
Sequence length 668
Comment protein Name="PYU1_T003197" Note="Similar to TPRXL: Putative protein TPRXL (Homo sapiens)" AED:0.174887892376682 QI:0|0|0|0.33|1|1|3|0|668
Sequence
MLLEKTQEYDKRVRALRKRLALDFRPLKDTLSKGLEVLIDPEAAVYCTATVEAFCDALFN
VIIKELHEEAATGVAPLDTKITVYHIQVVLRGHADFAQLLQSVESVMLVLEYFLDDATSK
ALYDRHLIATRDAKHLRTATDDSTSEEELIRMHARTRAEWQKREDDPFSEVDFAMVLKCV
HPAFTLSYNATILLSAVIRELLNEVCDLAQVDLVQRRVPPEFYLEDIEMPISRIFHVGDA
MGKQIAKTGLDCLERFRLRSRKGTTLTIRFRVFPGANAAQNFRITPQYTLNNVARETSFT
QLVPQMCKKCHVDATAMAAIYRGHQVDLLSTPHMLSMPTGAIVYLVAKKWWDHTRRNEAR
RGLLSSLRPQDAQLKSLVEATESKVKKKMQVSPAASVSSHLYGLQLGTAVMRRDDSLDAK
CMQQRSNNSNSTSSLQSVASTISSSSGTTASPMRSSTNMHAKAMPSPVAKSLALAEPKER
SVFDKDNPSSSACADASEDSLSLLLKTRARNGMTMPQPHAIKPPRARQSSSDNNVMEASE
RDALSKMEVRLERQKSRVTVRALATKNAQLMVTLDDAWLGFAAISGGVRSMNDKVAKWKS
VAAESEPQQEREMATAAAAAVSAKELEELEDELRARLDKTEELVVQTLAAKVLVAELVDQ
VRHLRNSQ
Download sequence
Identical sequences K3WE06
PYU1_T003197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]