SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003205 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003205
Domain Number 1 Region: 37-191,220-403
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.21e-100
Family Calpain large subunit, catalytic domain (domain II) 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003205
Sequence length 630
Comment protein Name="PYU1_T003205" Note="Similar to CAPN3: Calpain-3 (Gallus gallus)" AED:0.263338615953513 QI:0|0|0|0.5|1|1|2|0|630
Sequence
MQTSASRPAPVPSIVKTLSSRGKDESRVASDLARVKLQKEARTIIATAGRDLAIEECRRK
VAKISRECRMKNIKYRDPHFDLSVMQDFCLNGLRQKGEGLQGVAAPGTVRRVEDVYDNPR
FIVDGIAANDIKQGALGDCWFLAALATIANVPRLLESICVARDEQVGVYGFIFFRDGDWI
SEVIDDQLYIANGDYAEADATMRSVFPTEEEYVKAIQKGSTALHFAKCADSNETWLPLLE
KAFAKAHGDYSAIEGGFTGEGVEDLTGGVTTEIITRDILDKNRLWNEELTKVNDELLFAC
GITNDTLDQVRGIITNHAYSVLKAVEANGQRLVKVRNPWGKSEWTGPWSDGSPEWTPEWM
TLLDHRFGDDGAFWMSYEDFLKVFTDLDRTRIFTPEWTVAQCWTQGHVTWPAQFADQEFK
IALKHSSTVAIVLQQVDQRYFSGLEGQYDFRLYFRLRREGETEYFARSTQGIIMTRSVNI
EVDLDAGNWFVSFKVSRVKSGRATRDEYIEAFRKGQSDKFMHIARSFDFAFSKGNEEWFD
GITTEPEEEEDPEQAEAEPEQKPIPVSELDTTAVIGLLVYAKDPSLAVQLVDADPSVNVL
DPDDSSVQFFLEGSHDKSNFLSAHIASTTA
Download sequence
Identical sequences K3WE14
PYU1_T003205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]