SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003278 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003278
Domain Number 1 Region: 602-718
Classification Level Classification E-value
Superfamily FLJ32549 C-terminal domain-like 6.28e-28
Family FLJ32549 C-terminal domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 148-247,446-480
Classification Level Classification E-value
Superfamily FLJ32549 domain-like 7.72e-25
Family FLJ32549 domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003278
Sequence length 730
Comment protein Name="PYU1_T003278" Note="Similar to si:ch211-125a15.1: UPF0536 protein C12orf66 homolog (Danio rerio)" AED:0.0279356045132528 QI:0|0.5|0.2|0.8|1|1|5|0|730
Sequence
MSTATNRQSMEETIGRVFMTYLPNFFDALSRFQYQQALASLECEGKTDWKSWDAFSIMRK
LAASCESTYHLMKYLEPEVLHSDAIDLMYSKLVVLMNHLAEEIKPLIARQHHQFPVHSMT
GSDNHQSNNSLGDGFAYGDLGYYAELLDQAAEFFSLLKLLDGLLVRFDAFDHPLLETMKQ
STMEENRTLYAAMSTELRITQYDFTKSMIALHRLKKTLGSWSDHIDSLSEYPLFDETGLG
DDDDGLDGCEDEDENYNTLSNSMYSNSSFSNQSSSAFPIPGSINGGGESSSVLTRSSIRR
RSYTNIGGNDSYIEKSEEPLVRNPSIMSVESTTSAISEAHSTFSRLLSHSNLLKRGISAS
GVAIPFVSKGEVANIHQKPGDPYVSSGSSVLTNTLEQAILGGVTPGAGAASQFGAANGGG
NLNPSAAEMIASSMKRQERDDGFALPVFQWAKRFYRSLVAKFTLYFHQWLSPFERQGDFL
SHDLTRFIRTPMGISYLQLMDVLLSRGSYRGDENGAYIMLILETNELEDKGAHYYQNGYL
CPSTSRARPSQPEPEDSDHSPQQKLQTSGDTPLSRKQQQQLQSFTLSSSTSSAMPPQACH
SLFMQVDMEREEEQSDFSPLWGLRGWPAVFCYPNNESPLQHWPNIVSLIMDNRDAIKTTR
PVFNHTEKRLKVSYYITRVDPCMHLVLLLEGTRRPNEKTIQDFMQTLTENLQHSGAFEHP
RNVSKAPSSN
Download sequence
Identical sequences K3WE87
PYU1_T003278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]