SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003293 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003293
Domain Number 1 Region: 880-985
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000839
Family Fibronectin type III 0.0056
Further Details:      
 
Weak hits

Sequence:  PYU1_T003293
Domain Number - Region: 2061-2096,2286-2386
Classification Level Classification E-value
Superfamily TPR-like 0.00146
Family Tetratricopeptide repeat (TPR) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003293
Sequence length 2480
Comment protein Name="PYU1_T003293" Note="Similar to C12orf63: Putative uncharacterized protein C12orf63 (Homo sapiens)" AED:0.00531270256167282 QI:0|0|0|1|0|0|2|0|2480
Sequence
MGKDPMSGVKPPNASAVSQQSAPSSVEDADGVLVQQFTREFRQIVRQINEKKQLDVGTAA
GSESQQQQPLELDGDECAYYGPIAQKLVKLVNKLLHTTNALATAKKEHLLLEIGGKLYAA
QEFRAASRFFFRQIVDMYTQEEDYDGTESIGTLASPAPATAVHPPMKKLQRGEPYIRAMY
GMAMSEFFIQKRRDPLVRHPGTLEKMIASLRFLQTGMDAATALERGQPHQYAWLILNGSV
LMFSIARPLCCLGFAAEVVTFLKWVILAMESTVVLCTTKYILWRLQIFALIFECYESMAI
SHHQQEHLEARCRNAALKCAEYALKVVLRLIKEEELDLPLPKDVVAILAHAQTTANMLVT
RAKAAVNREILSKRQIEAAFPSSTAERIRVAVDMVESLTRMDTKCIGVLSPPSAPGIRDQ
LTELLGIVVELVTPLLSSSQPTAEQQLTDSTPSEPLSHVFPLAFHLMLLRHLFRVEKDDD
LEVMIIAARSRLARPTSETLAKTDADKCRHEVKLFEVLAELKHSQDKAGAQENEGVESIV
IETSERKLPLQLSKSRVTLPPSRVLLKAAQALSNCLYQGEGGMSQTNRDLLLAVSLKLWH
EYAIPMLHELDATEPSELPASIVKLASELLLAIHLAHTFIDADDLLLHGEVILRLSSLLR
LQKRNRLAIQGLRGLLERINSKRDELASFDTHFEALSRDPVAFSCSTISFDVDSDLSYSD
AREGQMPNARDRVGVFGTGSQFGSFFHDICCLQTDLVLLLYEIELEEASNIDMLPFQSAT
TTNNRCQLEPGTLLQAVETKLTTECRKSGWCRVLLNIQLMRHHHVNKSNSIKKFTALVDN
SMKMLERIEHHERDLQNHLKKASSALSEAQNRGLTADSNVPLPPIVVSRSSTAIAVTIPA
FQPSQPSLRKRQIAYYMVFAKPAGAGTAVSLNNYELPGTAEPVYPPQRQVTIGGLIPNES
YVFAVAAFDKHDDVIQGIGQTSDPVVALHPLPLVLCYGYLAQACYELNLVEQATKAARTA
YNTIVSRAASSRQLWQANPYYRHALRRDVIAKLPIPILNVAIHAIQILCHEELGDKERDG
MLYDPEQRSLLSRQVTVLEACRRIAIGVELASAAANMEAIRMLCFKGYRLLLPLLHLHCC
NAMTFAPLMTMYHALLTIPRAQWDVDTKSIFARIAFELFRIGLENRHCEPVIYPSLVHNA
LQPQDSSSDELSSGAVSTQSNEYHSFCETIALREVLHAARSTAVHAHSVLPNATAKNPPA
IPAAPTSKAVAVGSTPQGTPRQHGSIEDSPKLPLLQELLQQANFSMMDVIKALDAHASTT
SGIEHVEYACKLATVALQSGDESAVEACLASVKLKGKMSRQFRSTISRLGGASLLPEPVA
AAGSDPASSTELATSPPTTARSTKTPRQHNPQKRAAKDEPTTPSDVTMEAPPSSRGSQVV
VVHEDLGGEDDDDFLYLWGAEVFFVQSLLLYRRIVKLRAEIREVNVAHGPGHDPTFDLLH
AEHHHKEPESVPDDLQHADSLEQESQEQESAGQSKEDELMVVFGQFVEKISASCELFRLG
KAWQALQVSCQYLWNAIWIVWISPCHFGSLASSSPHWLDQFSGCVNCLLGMIETVVVAVQ
EQKSKGLASFSTGVIDGTRIQALELNQSLLRTSLASTMVVSSAVSALSTDLTWMVNFVSY
GIKALCSKHEWEKIVRIGKKIHFLLGNQAVGARFSELNFPVLIYAQRQLFDIASDELDAA
TTELSMYIREFTEGEAKKKKKKSRLVVEEVLTPEELAFRAKEAAMNEHIQRLTETRNQQR
DELQQLTSIYEGLTKAMNKCLQSLDAAHELIARFHRTKNDDGDRITLKNQIVSGYNHCIL
LSQQKRQQRLLCHAYQELGDFYLTCSDTKLAVKYWHEGLDNAFGTLNIVQNWRDVLAQGS
KDQEANGVSGAGVIGGDGLWVDLLSCCMLSKLVMHATSSSCFQSVEYSLMAAKVFGRLFA
SSLPHPTKEFLFGSYELGNEFWPGRDLLVDPERLPAFSFGVTLILVPDVLLQYEYYAVAT
MPVIAGYEFVARHCLESRDHVVNARRLRIEALLQCGRIKEAMLVLTEILHGVETPSTQEV
SKPNLLLAALSYHDNKPVKHEANAAALAWLLTIDSVKIHAELTQSYAEPLVLEVLVGILR
LIVCLSRHESSLGGDSAQLRASAEKTAQALLHLIPEEKRKESVSETETKDPHQMSWDDMQ
LAALRGEVLLQQSYLAHSAGLWNLSRELSVTALKARVDITHDEVAHQDSAASSTIVPLNL
EQELKYCLFRRHSTFIAKCRLQSILCDLAQGQCHAAVAQADLALNECRESGEDHLSERIH
ILRAQANAFLGKRDSAETALDQLRLISISRHTNCTLTFVHTLLMLSALGRARRTVSSDPK
ALVAAKDHLIDAERALDELLERDGWIGVDVNVDPNNDKRLNLYHPGIATYIHVKASLAQA
LVECEIEVSLETPKQSLANH
Download sequence
Identical sequences K3WEA2
PYU1_T003293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]