SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003456 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003456
Domain Number 1 Region: 15-127
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-19
Family Ankyrin repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 454-500
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000495
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003456
Sequence length 506
Comment protein Name="ANKP1" Note="Protein of unknown function" AED:0.0882694541231127 QI:54|1|0.5|1|1|1|2|0|506
Sequence
MGNVASWLAQCIYPDEQVLWQAARSGDAHTLRAAIAKLTPETRKYMEWQEPCSGRAALAE
AALRGHCDCVALLVGAGANCNAKDYRGNTPLHLACKRGKDDVVQYLLQVPNVFPFETNLD
TLTPLDLVRKKILKHESCSLSFERCLEELEKKFCVYSGWLYEERGNMLSMVSGISSLGSW
KRRFCIVLERGAPDILELALFSMKPCGMRPVCPSSVILYQVGAGMAETTDTKWFNRKDFA
FSIRGNRKENCHYDSTIVMEPLQFAAVDQAGYDAWKCFFEHQRQSLHARATSLYGQPVVM
LNRPPHALQQGHRTASVVALPTAEQYQYQVPSAQRAATYDRSESKPATAAPLSSYPAFAA
VTSQEQEEADLRRAIWLSLQTTGNCPSDPLEPAASPALPVSAPDWDDGDDSASLHSASAS
DGASSPAAAPAADAAPTSPLVNFGRAPSYSSIGECIVCFDGPQAAVCVPCGHNAVCMSCA
EEILETSCECPVCRTPIRELIKLYRV
Download sequence
Identical sequences K3WER5
PYU1_T003456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]