SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003591 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003591
Domain Number 1 Region: 2601-2746
Classification Level Classification E-value
Superfamily Anthrax protective antigen 5.89e-30
Family Anthrax protective antigen 0.0066
Further Details:      
 
Domain Number 2 Region: 5480-5628
Classification Level Classification E-value
Superfamily Anthrax protective antigen 8.37e-29
Family Anthrax protective antigen 0.0023
Further Details:      
 
Domain Number 3 Region: 4092-4270
Classification Level Classification E-value
Superfamily Anthrax protective antigen 6.41e-27
Family Anthrax protective antigen 0.0052
Further Details:      
 
Domain Number 4 Region: 803-850,1346-1482
Classification Level Classification E-value
Superfamily Fibronectin type III 7.02e-24
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 5 Region: 1519-1652,1881-1923
Classification Level Classification E-value
Superfamily Fibronectin type III 7.02e-24
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 6 Region: 6136-6172,6381-6463
Classification Level Classification E-value
Superfamily Fibronectin type III 7.35e-18
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 7 Region: 5644-5691,5849-5892,6090-6119
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000551
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number 8 Region: 2741-2871
Classification Level Classification E-value
Superfamily E set domains 0.00000000176
Family Filamin repeat (rod domain) 0.0073
Further Details:      
 
Domain Number 9 Region: 35-90
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000841
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 10 Region: 4660-4765
Classification Level Classification E-value
Superfamily E set domains 0.000000153
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Domain Number 11 Region: 3259-3301
Classification Level Classification E-value
Superfamily E set domains 0.0000734
Family Filamin repeat (rod domain) 0.0077
Further Details:      
 
Weak hits

Sequence:  PYU1_T003591
Domain Number - Region: 2893-2989
Classification Level Classification E-value
Superfamily E set domains 0.038
Family Filamin repeat (rod domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003591
Sequence length 6472
Comment protein Name="PYU1_T003591" Note="Similar to Ttn: Titin (Mus musculus)" AED:0.125078465497883 QI:0|0|0|0.53|1|1|13|0|6472
Sequence
MRIVAILQQQEQSGPIAFALKTMTATCCAYKADGVISVPSEPLNVQLQTVSQDALQVAWD
PPARDGGAAVSAYLVEWDPEPGVREAQVVQTRSNTGANEVQTVRTFAADVDEVQQVSTMA
TLFQEVQSITTRAAPGEVLGGVFTIELDTTVSGGSKQISGVIGYNAPASGDRSSVLEILN
AMSNIGSGGVQSVSRSTADPQGGYTWLLLTGSGANVVLNTPVNGNVIAPGSTFTLGFRGA
QTAEIAYDASDVAMQQTLEALSTIESVNVVRIGPDYQHGYKWKITFTSNSPLNTGDVPML
TVGANSKLTGAGAVATVQQLVAGNQLAGSFQLKYTNNAGTTATTGDLEWNCDAATMKSEL
EKINTGTLDVSRTQLPDPQGGFTWTISFLMLKGSFAPLTSVLTRLTESRTDSVVSKGLVV
TRTRPGTVQEIQNIKVTTTAAAVSTTTYFSLKVSFASQTTTTGPIPANAMADGTCMSSKP
EIQQIKVTTVDTTAAGGDNLVSSKTAFQLIYTSNTEAGTIEETNTIIANPALGDCSIAAA
AIKKELEALDGTVGTITVSSSATVATQMCTWAVTFSNQPGNLVQLQVVTPNNGAGPAGSI
TIGDDTISISTLTDGSIDIIKTELEKLANVAQVTVSASPAATPNTAQACTWSVTFDGNAG
DLPLMQVSVDNDATFGASKTTASGDTVAIVANRDGTSQVLGGVFSLEFDGQRTGYMPFDV
SAVAMKNQLEALSTIGDVAITRSNADPNNGYAWTISFLNNLGDLTALQPDMLALTGTAPQ
IQVQKRVKGILPRFNSKDPVNEIPSAPTNVSLASVDGTSIAVRLNAPLSDGGSPLDAYRV
EYGLNPIRDEVQEVQLRVPVVNEIQTITTSTNTVGEVQLVHLTSTYSGTVANEVQRVSCD
ALSAGTGSFTLSFLGETTAPIYATETSTTVIQTILQELASITSVSVSFYGSRTTACASCS
TVTATGCTSGLEITFLSIVGRQGAMPYLTANTYNLEGNRRVDIARQTVGQAPVSGTFRLT
YLRGRDTDTAPLLFSASAATVQAAIAALDASVTVVVTDGTSALPAADIAAGARLWRVTFQ
NSGYIPDMLVRPANNLLMGNGANIKIYTKEATYGAVPASVTGNRVTGKFRLALGGHVTDL
IDHDASDTTMKRNLEALPNIGTVTVTRTGPSLKNEYVWTVTFIANPGSFPIGAGNIDPLT
TDSTALLGTNSQITIATLLQGSSPVDGTFQLKFTDGVAPVQNTIDLSPHETADGIQRALR
GISSIGDVSVSRSTVTNGYTWQVTFNNCRASVCNIGDVNMMTSDTTKLTGGAGTSIPTVT
VVEVVKGVGPLQTMLITDLSGGEPYEALVSGLLYGTKYYARVSFHNAVSFGHRALSVPEF
VMTKNLAPGAPRPVLLVSSSATTITLAWTSPTVNGGATVSGYELWLSEWGDVYRKVYDRP
NDALTLTTTLKTTADNAIESGKKYWFKVRAINFCTSSDPSASCYGEFSAPVEYTVRSPVM
PEPPASLTRDSTTTINTAAANDGIAVVNWAPPIDNGGSSITGYELYMDDGSGWVKQTMQG
VFPYGYSQSIPNLKEGNVYRFYMRAINAIGPSAKTPVLSIVLANVPSAPSAPTLVDVTAT
SIRVSWLPPSSCTSTLTGCNGSPLLGYKLWEFPGVTSGYTVSGSPVNNEIQRIQTTVATP
VPETQSITIVDASGQFALYVNGKMTALLAAGTSAAGAATTAQVKAAVEMCGVGTVAVTST
ALATGMTWTVTFSTWQGPLTAIVIVPDKLTNTVLATVYSTQVTRVQAGTSALGGDFTVSF
RGFETTNLAVSTTAAEMKRQLENLPSIGVIAVSTTAGTNNAMAWDITFLTELGDVPLMKV
TSGRLTGGASKILVSTMQVGTPGRIVYDGTMAPNVLAFSSMNLVPDTLYAYVVVAINAAG
DGIGGVSTPAIAASSGAFSFQTVAHGAALVQGMAGIVYEVQSVATSNLAAGTFKLRWSAT
GPWIGPISTAMTAAQLETLLPSTDPSLGEVHVSRQDLNGADCVWYITFADQVGDLPLLVA
DDVVHVLIQEFVKGEANQFAIAPRKASGDVVTYATMPPGFQGQDLFWTELWSSPPSVVDG
THSFVSDGGLAVYNPVVYEIQTITFNGVAGTFTFKLDTSTTRLGGVIATSTIAVNAATLA
TATTSDATASQLVKTSLETLSNLQTVRVSRVKNTGGSVVSWTYAVTFISNLCDLPSLQLV
GDTAFMASSTLLTMTPVMFTEIQKGVCDVQTVTTSASVESSAEIQSIRTWLDDSGTLKAL
GGTFTLAVGGTETITVPVTADAATMKTLLESVSTIDDVTVTVTNSNYNTATGLQTWLVTF
NEILGSVPDITVASTASLTGYKAQVIVKEVRRMGLSLGGTFVLNFMGDTTFNLPFDIEPL
QIKTELENLQVVREVDVKKEELFNGNRWTISFTKNLGDLPKLEALPYAYEIQEIETLEGS
PTPLEGSFTLSFIGETTSAIPFDASRAVMKAALEALPSVGLVDVTRTDKLDAGNRFKWQV
TFRSKLGNIGNLVPDASRLTGSFPDVVVTELQPGSTQSLTGNYPKLSVFKKQSGFPRYTA
RYIPMQARSNYSVAVRQLQSGGLAALYYDNYWFQDEPVIMRVDPQLQFDWGHGAITNYGR
DYISIRWFGKLAAPYTDSYVIYVKSSEGVRVWLNHTLYVDTWEQDAGSGGMRGTNENFHV
NLVKGTFYDIKIEYHEDTGDALLFVAWSSSYLPLQPIPKSALYHGDHILGSPFAITVTPG
ATDFPHTTAFGQGLKTATAGIMAQLTIQAKDQHGNNKTTDGDSFDISIAGNVLLAPFEEP
LYIGDGQYRVQYLPAVSGTYQLSIKTVDGIDIYCGLGKVNKCSPFRVTISPGATTSHTSQ
ALGNVVTSYGVIDGLVEAVAGQVSNFTIQARDTYGNAKWLAAVGSDRFETKMVLVADRNL
QYRSSVLSVTPASSPLGIYQMQYSIPRAGIYELQTYLNGSPILMCPAQLCQVLGTPASLK
VVHSELHGPMSTVDDATTNALSTATSGHATSFNVYARDTFGNLRIGDRTTNSKSTGDGRS
DVFLVVLRGNDEEVRTSSTVQILQSTAGSSGYFKLTYGSFRFQLCANCVTALTSGTSLSA
NVNLVGLLLPNTKFAVQECIFTAVSVTAATISVASNHGCAAFTSKQWPLQVASTTSGKLT
PLIPYNVNAAALKYILEDLHYPNAATVKVDRVNVVGGGYKWLITFISHLKAWSEAHLAVE
YPNGFASSMYANPLTVSYAAAGGVYPVHYNPYYAGNYTMSITTWDEQVHVSGSPFTVRVA
GDATDGASCLAAHGNWLVENFSEPLIELNAGEELRFQVQLKDTRRLEQQVIRLRAVALPP
VATVQRVFVQSASFQLSFRNSPTISLADQDAYATVKTKLESLYTITDGGIQVSTASDFAS
DTKVTLNHAFLVTFTMDSGTLPTMDAVGAQVSTLTQGVTSYRKEIQTLTCTSSATPAADG
NFIAMFGGQTATIAANAALTGPAGGTSFSALLTTLLGGSAVIVYAEGTQTTVCAGPSPKR
IFIQFDQLVGDIAALAYSTPVGSTLVITSENDSGGGVKGVYPAWGTFRLFAGGSDNANDV
TASIPFDASALAVDAAIESLLTVDTVSVTRDWFDITTETLAATTVTLVQWTVTFTSHAGN
FRELVPDSMNLQMNDDGQFKPFVEVRELARGTLGNNRSLAMTSDIDVTLTTVLEDPGVQE
KQTLLCRGTETFTLTYAGNSVVIAPYLSLSELQIKLNTIISTGVRVHSKDTALESTYFPV
CSVASAKAIEIVFEVPQDVPLIQWSTTSNDIYLTESVKGQARKDTPIAIANKEIHQLTCS
VTAASAATASFDVTFGGDTVTIAANTAIAPLQTQLNALASISAAGGVDATSAQSQVCLVD
DGITVPAPIRIAFRAIGDPPLLRITNRRDGILQATVVESTKGTRSITYDGSVPGLFNVSI
VPEIKGTYDLSVKVLSQPVFFPPNVVVHPTLASGFDTVHTAPAVVVQGIPQRFTIQAIDR
FRNKLESSTELGVDGFIPKLVGPRGVSGTAVDDDVYPVTIREAQSNTNGLFHLGFVPQIR
GDYTLTLQRRQAGGLTASYFRNVDFTDMIASRQDANIDFRWGEDSPLGDPFPNKYYSVIW
AGELRAKATGTHTFTLHADDGVILEVNGITLLDSLTISSPMAVSSSFNSRSSSADTVMKK
GTFYTIRVKYRTRDAQSFISLSWNCDATFEAEIVSPQSLFTATALANTPFKIRTYPGALD
ASQMLNSIDAFMYKNDSSSGYQDQVVTARALETFSFEIEAHDAVRNTKFQDGNSAFEVSL
VGVDGWALIGRTNDVITGTPITIDPTILCKACATDLDSTTNILTLNADIARHLIAGTRFR
VINANPGTLARKRDCFLTCKATTAFVAGAVTLEVEPKHGCEAFTSQSFAVSGVFPKHWWY
LGTCAVLRGDMALTSCSNDFTKLLSPVSLERGDLIVVGSESHRVHTTDGAIGATKVPLTR
AYLGESNAFVPVYKAGDVTGRHVVSFVPYVKGKYQLSVKVPHVDAVYAVTTTAASSLGGT
FQLYFGKTARTSQIAFNADAATMKTVLESVNGIPAGGVTTASSCVNNDATQGCRWLITFA
FDTAGKMELKPVYEGVLTGNNAKVTAQVLTEPRSAQLIRGFPKTIEVRPGPTNPSVSTAY
GRGLYTSVAGENATFYIQMKDTHGNNKDDRDTPDALRMHVFPNAAPFTDTQVATIGPIRY
MSEGLYNVTYSPIKSGVHTVTVTTQTKPEIQQVSTVFAQITDRGGSFTLRFKGQATDPLA
FNANASEVQTALLNLPIFSAEGYRPSNGNATMTQIKVSRSINAVNFGFDYQITFTSVPSY
IDMKQLDFVNNLYGANGNPSIVVQVLQRQGNEHIKTTSTLGRTVVNEIQVVRIETTGTTL
TGGYFQVAFNGQVTDLLRYDVSASAFQAALETLPSIGIGGVAVTKSTVSLLGSCEWTVTF
VGAVAGNAQVEYWSSTRYTRDRLVPNSYLVGDLPPLRLVGQTLIGGTNPTVLIFEGGATS
TGGVVSVNGRSPFTAIVAHGTIVPEKCTAVDTATPYWPGTTNSIGLGGLHNGKFHSLTNF
AIETRDVHSNLLDGTGNGVVGRPVNELQIIETSITGAGIGATLAGTFQLAFGGQKSSALP
YNAGIKDVEAALEQLVSIGGTTVDTNDVKTLVVLGTVTATKTSNMLQSGATDFTTVFSVN
DWIRVGSLTGPVFTVITITATSITLSSPYFGATNTATSVYKQAAPKTGYTYLVKFDSELG
DLPSIVMDPSALSVTGLGTVTTKVTACDTRRTQKLQTTANTQLSGTFYVSYRRDTNRTPM
LSWNVDEATLSRALEYLEGLHTVSVSAPVPGLNGGFTWMITLVSTEVDDLDLELLYAEGY
MLLGEQARVSVDAVCPSTATSVGEVLSSQSGRLGHSFVATLTGADTISADVTYLSAGKYV
ATYETPRADSYTLDVQHTKSQGLRGTYFNNRWLYGDSEVVRIDRQVDFTWRDWITPTAKD
YVSVRWDGYIKPAFTEDYVISIIANDGARLWVHNQLVFDYFDNEIDESKLPNAVEFRGNT
TIRLVKDRLTEILIEYKENAGLALIQLLWESRSQDKAVIAPERLFHRSAPIASSPFAITT
YGVKPTAPVNVSLAIAAFDALTVRFYAPLDDGGSNVNGYLVEWWTTGAYGTPEVQMIKLD
KANMGGTFTIELDTGFKTGPLAVATVLYSDVEAAIEALDGAGDVTVVMTSAPASTTIDFQ
VTFNTRTQTVPTMKVNGNNLIGSGLFAKLRLPSHLVPLELVERVDQALIGSGGAASSSME
AGSLDASAFSFREVPGYFLTQHPSSTRYKFTINNLKPGLAYYVNSCSSLRLAWLPSPNVN
GAKVTKYLLEWYELPATQLEVQVVKIAGQSTADPVSGTFQVAYNGAMTDDLPIDVDEAEM
QQSLEALATLRSVHVERSPASIKGGYEWTITFLAETPAVLGKVLQVASTKMVATAVSVDI
GANLDPAHVGAAAKTVAAVQGTSTIMHTGIESYAAIGMYMQVTGNGAEAGIWRVMSVTTN
TIKLDQAFRGATGSYTAQIGWTVPGTLPLNYHALEVTNTTTPLSYTISNLPPGVKYYARA
SPPDVVILEPIISTGSESSSSLQMRFNTTHNHGGAKVTQYKIEWDAMDLEAIEDRAVASA
TAATALQNEVLFSPFTTQMLLLSADAYDVRGSFRVSFMDVVTSSTLPWDVGADELAAALE
QLESVGKVHVRRRSTGNGFAWFKSELIPFDVSATALQQALYKLGGGSQDVKTNVGQVDVF
KKAAQAFTGFEYTIVFRSRLGPHQPLIGCDASALKSTSAQAVLRCDTVRTRVGALPALVS
DLYGSAIVQEADIVDANGLATFVIQELRPGVQYHVRVSAWNGVGNVFGEPRYSTPAVVPV
QSQPDPPRDLSITALSASSVLAAWTPPMNNGGSPIQQYIVLYYAAMVVALLP
Download sequence
Identical sequences K3WF50
PYU1_T003591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]