SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003592 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003592
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000066
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 2 Region: 98-140,275-367
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000188
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003592
Sequence length 373
Comment protein Name="PYU1_T003592" Note="Similar to Ttn: Titin (Mus musculus)" AED:0.820432634488848 QI:0|0|0|0.5|1|1|2|0|373
Sequence
MFRFAASNAQYQSDFAVYTTPFQTKTRTPFQVKDVLASPLSTSSIGVRWKAPEYDGGEAI
THYKVQWDSSNQFEMQSTYAGSDTVVATQGPDSSSDQVLAYTITGLDVNMPVFVRVTAYN
SLGYGEPALATPVSTNLRVARVVVKSTSLTNATAAAQKFKLKFQNFATLSTVSIPINGDA
LALQNAVAALDIVGTVSVSRNDHSLGEGAVLFDESGVDTPFAYRMEWTITFLTPSADAID
PNALGNLVVTLDATPVGVIAQADISVYEVRTATSLVSIQPQAVPSTGPLDVRISVVDASS
LGVSWAAPSSASSPTRKYLIEWSDTSDFMQSTPQTGGTSYSIAAAHTQMVPGSTKTYTIR
GLSCWQVWLTAMG
Download sequence
Identical sequences K3WF51
PYU1_T003592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]