SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003593 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003593
Domain Number 1 Region: 35-56,221-356
Classification Level Classification E-value
Superfamily Fibronectin type III 5.72e-17
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 2 Region: 373-428,651-689
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000285
Family Fibronectin type III 0.0058
Further Details:      
 
Weak hits

Sequence:  PYU1_T003593
Domain Number - Region: 698-766
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000638
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number - Region: 13-75
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0201
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003593
Sequence length 788
Comment protein Name="PYU1_T003593" Note="Similar to Ttn: Titin (Mus musculus)" AED:0.11660329531052 QI:2|0|0|0.5|0|0.5|2|1|788
Sequence
LIPEENGDIAPEVRVSSLQVSFLRPTILLPTDLNGNGGSTITKYLVEWSDKDFLMMKNHV
QVISTTSSSSLKVTGAFRLVLDTTGCTNCQVTSLHSTSAIPFDATDLEMTNILQNLPNVG
QVSVSRAPCSANNECTWKVTFVSEVGVVPDFTVAQNLLSTENGVVRIHISSLVINGGQVG
DLSGAIYCPSTTTVGGVATSNSGPSACGFVVPKVETPLPYKYLIQGLTPGTTYFVRVSAL
NALGYGIRRASAPTSMAVPFEPPSVPRSLFNTFASPVLTLAGPTALLVAYGPPVFSGGTP
VTGYTIEWDPKPTFDSGTNGDALGQVIRMGGSGGKYRIDKLTTAQWWYIRVYAMNAKMGA
GLPELTSPKREMPRQKPLPPRDVTISNGRTLPLGYSLNVQWRAPSDLKDALTAISAYRVE
WYQKALTDPFFGLPVMQVVQTTGTITSGSFTLAYGDGSERFPYRVLPGTLNVVYGQNYVT
TSTDLTGLLARGDVIVIDDVTYLVAATGTFSSTQLPLADATNLAVKLGSTLATTPMTYSG
TTKSSIPVKTLWKTIDMSYDVTPTAVKEALEMLPTVGIVHVERFQVGTVGDNNFKWYVTF
STQVPTPSALPMLTVNERNLVGTNNADVSVSVTQLGQAPLAFGFAMVSATALASSDNSVP
FSYNITQLANGVPYFVRVAAINDIGMGDFAISDTRLAPTRAPLTLANVKIRTLTATMMEL
TYDQIATSGGEPVDGYRIEYDRVFNFSSSVKQSLDVVPTTMYHRVTTAAHTGPFTVSGVR
SRAKWTPT
Download sequence
Identical sequences K3WF52
PYU1_T003593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]