SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003594 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003594
Domain Number 1 Region: 530-615,906-947
Classification Level Classification E-value
Superfamily Fibronectin type III 7.58e-17
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 2 Region: 214-278,521-561
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000122
Family Fibronectin type III 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003594
Sequence length 951
Comment protein Name="PYU1_T003594" Note="Similar to FNDC3A: Fibronectin type-III domain-containing protein 3a (Homo sapiens)" AED:1 QI:0|-1|0|0|-1|1|1|0|951
Sequence
MRDVLALEAELESFSGIDDVRVSRTFTLSPTTMVYTIEFLGVSVRGKLPSLQIRDVGING
CSAFDGTPAGTVPIVSVVVQKEQLAYATIYQAPTTRPIPFDATDEDMKAALEALSSLPNV
DVTRKVAKFGYDWKVTYIAFNDPRSPPTLVANGFALQAVQDPKVTVTQFNRRKLDTRAIS
AGGGASIFVRVAAHNKNGFGESSVPVPASIRLANQLPSEVLYPYVEVLSSSELLVQWDYP
WNDGGEEVTEYKVEWWSSTLNGGAKQSYVLHHLESPRQIADVNTISISAPSAGSNTYLSG
TFQVGFDGEWSSELPYDLSAVMMQSALKNLSTIEDVTVDRVLNANGYTWVITFHQAKYKG
NQHKKHKSRLDPSTSHRLQVSGTNLLLCTTSLRDSCIPKLENGIMPSISIGTRQEIQALT
CTGTPGAATGFKLNYMGVETALIPSNAAAADVEAALENILVAGAVSVSFSNPAQTTVCVT
TNAARLLVVFDTELGDVTLLTVSGVSAGLIIPPVEELRKGRTQMTPGRMPYSFVVSGLTV
SNVYNIRIAAYSSIGFGPFSVAQPVRGVIPVMTVPSAPQSLTVQTRLSSSTLLMVWEEPL
SNGGSSVTSYRVEWDVNPAYTSQCGERPEVQTLVSTHTSEPAAGDKYKLLIGTDVVGCVS
WKETDANLQLKVRALGGVYANAEVTRVGDGTARWDFGYTYKVTFVNPVTVTMNAFPLSIP
LLSVDKLDVNCNSYQGNIVAKRATFGPGLDDKFAQGKIDSANNECSSLLNEPIAQQTITK
AVALTNARSLPAIQLALAATTTSTPVGGAAAGQTTLLGAHAPILCDLCVQKLAGNTLTIT
SATLVGVINNGDYFIVEEVLTDTVAPSSTLPRKCVMKAAVAATTTSIIIDATDGTFLNGG
CQLPIAFESKAWALKRFNMRAHVVQDLIAGRDYSVRVVTRNMQGESQAAMA
Download sequence
Identical sequences K3WF53
PYU1_T003594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]