SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003665 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003665
Domain Number 1 Region: 480-644
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.02e-28
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 2 Region: 849-1065,1095-1280
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.05e-22
Family Reverse transcriptase 0.054
Further Details:      
 
Weak hits

Sequence:  PYU1_T003665
Domain Number - Region: 208-233
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00117
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003665
Sequence length 1369
Comment protein Name="PYU1_T003665" Note="Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94 (Nicotiana tabacum)" AED:0.462773722627737 QI:0|-1|0|1|-1|1|1|0|1369
Sequence
MTDKTKTIIDKFNGDNYATWVRYMRGVFLTKSVWEVVNRQDTPVFTDARIKDEYVRTNNV
AFGLLLLHIDAEYHHVVDDCEEAWVAWARLKVLYQGSQKAGRIYLKRQLFSIEMKESDNL
LHHCNEVLNIHAKLVSIGAKMEDEDVAICLLRSLPKSYENVVLHIEMSNADLKTQDVIRV
LNNEHVKRSGEKKTVKTEDHAKAFNAENEPRVCSFCGKVGHTADRCWSKNKQGGRKPIRN
GGNGGKRANYVERNYYDDDEVSLAFAVSMECGVTSTKEGLRGLWAIDSGATHHICNDKSK
FCELDERDHGDLVVANGNKTKILGVGTVNERVALPNGEVRDLKVVNVLYVPSVGKNLLSI
PQINKSNKFQVVFDGPSMNVLSKSSSKVVATADFADGLYWLRVVPSEVSKSAMTAVRASS
ASTLHERMGHASSQVLRQLVDKAMVKDAEFSPNTQDLSTCRGCQQGKMVQKPFKSNEEKR
TYGVFELIHFDICGPMEVESIGGSKYLLLIVDEASGSMKGFCLQNKSDSEDMLKKFVIQV
GNQFNTSVKFVRHDGAKEFATNSIKQFYADRGIQQQVTVPYAHQTNGTAERAIRSVVTIG
RSMLHHARLDKSFWAEAAMTAIYIKNRLPSPKSDTKTPFEMVNKSKPSVKHMRVFGCLAY
VLTPKEKRLKWDPKSRPGLFMGYEESSKAYRVYDIEGDKVVISRDVNFDEAVIGGTLLND
SAGGMTDILNRLEDIEIEGTRPLSAFKYTGKRRSGASESAEFPSSTEQTTDASSTEDDIG
PEEHTRRSSRQRTSPVEWWRASANMVEATDFSEPTSFQEAVSGPDQVHWRNAIRAELKSM
RLRGVFRAAKLPTGQRAIGTKWVFKIKRNADGTIDKYKARLVAKGFKQKYGIDYTETFAP
VVKYVTLRMVIGLAKLFGWPIEQLDVVTAFLYGQMKELVFILIPEGMEVECDFDCLELLK
SIYGLKQASRVWNETFDEHVRSIGFEVSKFDPCLYIKCVEGHCVLLLVYVDDVIVTGSSV
DLITEVKHELKQRFEMTDSGACKFVLGIELIEHEDGGVTLCQRRYIDDILKRFGMEDSKS
VTSPVDISMKMVQVENQVPATKVPYCEAVGALMHLMCATRPDIAFAVGMVARFMETPQDV
HWTAVKRIFRYLQGTKSHGIRFKSSGELDFKCFSDADWAGDVADRKSTSGYVFKLAGGPI
SWGSKKQSSVSLSTSEAEYIALSLAIQEGKWVHRLLCEILVAAGVETPKLVIFEDNQSCI
KMTKNPVNHGRAKHIDIKYHHIRDEVKSGEVEVEYCSTSVMLADLLTKGLPGPRHQELTE
GLGIQVVDLEGAIEMYRVCGTTCYRTHLRGRLYETLVYASVNIGSSHRA
Download sequence
Identical sequences K3WFC4
PYU1_T003665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]