SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003733 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003733
Domain Number 1 Region: 505-650,847-998
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000449
Further Details:      
 
Domain Number 2 Region: 14-45,91-153
Classification Level Classification E-value
Superfamily DUSP-like 0.0000000144
Family DUSP, domain in ubiquitin-specific proteases 0.0089
Further Details:      
 
Domain Number 3 Region: 328-387
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000211
Family MBT repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003733
Sequence length 1000
Comment protein Name="PYU1_T003733" Note="Similar to Usp15: Ubiquitin carboxyl-terminal hydrolase 15 (Mus musculus)" AED:0.144219718334763 QI:0|0.6|0.33|0.83|0.8|0.66|6|0|1000
Sequence
MDDSTHSKRAKLHDELTRLMSDERMEEGDSWFLVAMPWWDQKLRLGQNGAVNGHAATAAA
VEDDDDDDAEKRKNDDGDEAMDGETRHDCGDTDSSKVTNEGLVDLEFSSKKRKCIVLKPM
LAEGRDYRLVSESVWNRLSHEFSYDWEIPREVIARGPTQKLIVEVYPVMFQVFYWRSGME
APEEALDKREKPIVVVASESSPIHEMKEQIRDAMKEKAQHFFPHIAPKDLERRVQICYRE
SETAPWTTLDDAITPAETPKQGFQSASLYTNRNAQPKASCVGDLELEQRDYRSGKERFHH
LLVEARYRNAEDPADWRNGKFYSEIKANEWRYELELDQVIDGLDSDNKWYESRVIALNDR
SVRIHYRGWTAKWDEWLPRTSERIAPLHTKVRNWRAFEVGDEVQVGFPIPGKNFPEWKNA
TVTELERFELTGALKIKVSIDGEETWMDAQDEMLCAPGTHKAANAVTMATTNLYPRAAPS
PSYNSYGRYGDRGRDHNYEYGRGKPDFKGVVGLQNLGNTCFMNSMLQCLINAPPLKEYFL
KVDEETKKAAFQKDINTDNPLGMKGMIAMEFASLVRKMWGGEYSVVSPTGLKSVIGQYAP
QFAGYQQQDSQEVMNFLLDGLHEDLNRVKKKPYTEAVEGNGRDDVEVAREEWEVYLRRND
TKMALKSIDSSNGSGKPMRLVALLHQAPSASPTDDRYDGGENLAEEEETHGSKQRRVEVE
LFNTPLLVSIDRECTKADVHKKVWQIVKRLVSSNESSADSFGCEDNQTLPYRLHVSQPNG
TVSIIRDFARSDEPADLPDPNERTHCFTVEWSKHRYQRGYDESSAKRIALHESMKNLRIS
SSPNNEITLLNCLTKFTEREQLGETDTWYCPKCKDHVRAFKKFDLFSLPKIMIFQLKRFR
YAQSSFYMHRDKISTQVTFPIASLDLSQYVIGPQRSTPLIYDLFAVSEHSGGLGGGHYTA
VAKNPENQRWFSFNDSFTSETTAQKAVTPRAYVLFYMRRE
Download sequence
Identical sequences K3WFJ2
PYU1_T003733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]