SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T003826 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T003826
Domain Number 1 Region: 108-171,202-300,341-377
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.54e-18
Family Papain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T003826
Sequence length 635
Comment protein Name="PYU1_T003826" Note="Protein of unknown function" AED:0.15705085163052 QI:0|0|0|0.33|1|1|3|0|635
Sequence
MSPPRSNSYGALGYAHEDDAFLGPSEAPRRSAASLRAWGKIAIGAAVGLAGVGYCVNVQS
SLQAQQEMIALMQEQLQAMHSVVVQSAAVQNRATVSNSAHSHFSLSSLSSKLPPKFHVKH
VTPLKTQDNRGTCWDFATIGTLEQSYRAQGVQNGWLKPDEYVALSEQAYGAEVLRLCSGP
PGSPQQVACLIPGNQIWKNSTEGGESGELFYLMNGLKDSIFPDTICPYIPDDGNDTVCKG
LTPEKRKTNPLKVTIRKMDTYYDELAVKRALLRDGNAMAFTTATPYATYFYPCVGEFLND
PRCNPASPKCTLCPAELPQTTCCIPITGRESYNMDGEFITTPSMMPEGGHVMTLVGYNDL
YRTTQGYTGGFILKNSWWDGTHPKLGPTHARGSHTAKWWMQEVSDWEERRMCPNSHNPEN
WYQCGDFGEVIQRNADSGVKVPLPLSRSEVGEFKEGIESCLSEETELYAKTNFQPLHLRC
TDSSYCLEDKDIMYFARNMTEYGDRMQILCLYEYNTVSKNASEICLPPLLVQQIAYVLSP
VDDEILTNDPDVCGHYFYPYEVQKQYNSQFGNFYVNNFEVKWHPQSYVANERHFPEMDYT
DIMHSTRQQNHYDFVGPFPFARVVASKDLPKVDEL
Download sequence
Identical sequences K3WFT5
PYU1_T003826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]