SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004008 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004008
Domain Number 1 Region: 105-494
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.51e-78
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000569
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000311
Family Ubiquitin-related 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004008
Sequence length 496
Comment protein Name="PYU1_T004008" Note="Similar to UBP6: Ubiquitin carboxyl-terminal hydrolase 6 (Arabidopsis thaliana)" AED:0.20058458165875 QI:0|1|0.8|1|1|1|5|148|496
Sequence
MVSVSVKWGKQVFNDIPVDKGASVATLKAQLYALTFVPVERQKLMSKAWKGMLKDDADLA
ALDKLVDGVSIVLMGSAEVVEQPKEATVFIEDMASKDVAAAGVVYPAGLTNLGNTCYMNA
TLQCLRPVKEFRDALKQQAGGVSADLANNFTTALRDMYGQLDGSIDSITPALFLTVLRRS
YPQFAQQSPRGGGFMQQDSEEFLSTLFSTLQRSLTTPVAGFPALTPAPNMIDALFGLEMN
EKLECVESDLEPPIVKTERALKLVCNITIETNHLAEGIKIGLEGVIEKNSDVLGRNAQWK
KTLRINRLPKYLCVQFMRFYWKLTPESRDHTGVKCKMLRPIGFPQVLDVFEFCSDELKAS
MKIARDKNAEKILNEFKDTKKADEAEEKKESEDTEMLSAEDAAALEAAKSMSMGARSPGI
GLPVDFQGNYELYAILTHKGRSADSGHYMAWVRHEGDDWFCYDDDDVSPCKTEDINKLKG
GGDWHMAYLAFYRAKN
Download sequence
Identical sequences K3WGB7
PYU1_T004008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]