SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004175 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004175
Domain Number 1 Region: 298-487
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-24
Family BCR-homology GTPase activation domain (BH-domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 69-190
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000000000981
Family RUN domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004175
Sequence length 1008
Comment protein Name="PYU1_T004175" Note="Similar to OXR1: Oxidation resistance protein 1 (Homo sapiens)" AED:0.0714995624300254 QI:0|0.42|0.25|0.75|0.85|0.75|8|0|1008
Sequence
MLGKLSHWLSAKLELEDKEDDSVRLRFDALTRMKKTTLDVVQTANERLLTDDTVLDENSE
AAEGDTTSAALENCLKLGLKPQSNQDISLWNVLYSSSLVVDEPDLVQSIQTAALLSDTDA
GKARCWLKIALNKHALESTLLLIFSVQCDQVIRSSYEEWALMRCCEGMGLFLQMVMDIRN
VHFAIRVNDDPFQIAEPKETPTVPIAGAPDGVEDSATATTNTDTTNELTEEVTVSADKLT
NAVDSAIADEEFVEVSSMFFPHRHKGIKPWQYVFGVGISYLAKNPYHSRFALIDPVLAIP
NIVQDCIDFLMENPDSPRLFRATVLNVHINQLREIVETDGALPPDLDAPAAGAILMDFFK
NLPEPLLTSEKYEAFIASGRLRDEEASIRNITCLVQDMPVCGKFVLEKVIGLMHFLLSPE
HTEHNGLDIATASTTLAPVIAFKKEPSKGPLGQRRSTHSQHQDVRYAAVGAQVVERMIKH
YDVIFQDVRVQVSDALTRLEAKKSALLSIYQLFKMKPQVNFLSDKQYMEEITKAFTENTR
SDTSPPQSPNNPDKATTTSVPKVTSPLRHRTVTTSNPFQQMQLRAVNGLTTSLNAAFDRS
VVEIWEKHGFNRPTLLDNFDKGGVLLLRSVAYMLKNDSDVLQVLYTRALPSAAPTYDAGL
VSSAICESLINLLKLVPSPEHPSINIVALSTEPFWELFDEEAYFYKLFSLMFRIFDQLWD
ALDPEEASFTRVFCDTEAKLNDLLGKSPSSVEDVRNEWEELWKLLTDPPELGEDGDEEGG
STEDEASQTSPLVAPPPSPPRISKKPSFTFRAEDYKTKLMNPSSILTLDQVAYLDNAIPI
TCQLCRWCLLYSTETNGSSLHTLLVLTRGQSPTLLVIKDDQGNVFGGFGSDEWHRATQYY
GNGETFLFSFANHKGSNNAGFTKYPWSRRNSYFMLCSEESLVMGGGGSFGLYLDSDLASG
TTGACETFSSRPLVSAQEFSCVHVEVWGFTTGDKPIAQKDPRKKSVLD
Download sequence
Identical sequences K3WGT4
PYU1_T004175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]