SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004293 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004293
Domain Number 1 Region: 135-505
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000448
Family Hermes transposase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004293
Sequence length 780
Comment protein Name="PYU1_T004293" Note="Protein of unknown function" AED:0.386043533930858 QI:0|-1|0|1|-1|1|1|0|780
Sequence
MSMSSDAAADRAREELVLAILTQDRVAARHRLGGSGGNTLPYGWSLLENDHFKRALQWLR
PDFEPPTLHDVRHAHLPKLHAATQADIQTFLKSASLLTIVCSTEIVADHKRNIKWFAVDQ
DCRSELLGIAANVATEYPEEIAARVRQFIQQIPRSPTCMLHFCNDSFGAAHVARGLLKKK
NPAAASLMSSGSGVVFVGGCMMQQTLLLFRDMLETISCVNLALEKCMEVVSFLRTCKPLQ
QQLGVQVCVPTPENFHSFIVCANQLLALKDTLQRVVSGENDADMATYLLNAAANNNTSSS
RERAFMDAVGDDMFWMCLAFTQEVMRPFAYLTVLSDMGHATSAQLLLCWVMLQNTINFSS
MVLEIDKDNFNMMLVDRIRMFSEDHVFACLIFDPRIHGLSLSAHGKRKARLIIADLGTKL
NPSINRVQLVEQLLKYLNRERPFDDDDSWAMMASMPRLFWMEYLADMPELASVALAVLGF
HSHLMPLEETWWTCTQRHRRTSNRNNASSLKSGVLSAELEQVRFHYSKTQSSNSAESAKK
QSLSKYRKCLIATGGTSAAAGRDRPEELFADDDCGMISSLPFTLSEEITDEDKTRAFRGA
EIRSSPSQQLHSTSSSLHGLDCASVALRQFKYWLQRLDEHEKNLPVDEVDADGSLQRFDA
EWLELSVETAQQIRACVDKFVLDHPSSNEYAASASSISAGATESASDPLFATAASSTGTD
ERGATSENSEEDEDGDPRHEVQDRFDHEDPSHSHHHECEEDDGDDHFTVHEGAASDVIGV
Download sequence
Identical sequences K3WH52
PYU1_T004293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]