SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004371 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004371
Domain Number 1 Region: 965-1383
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.12e-105
Family DNA polymerase I 0.0000114
Further Details:      
 
Domain Number 2 Region: 47-92,123-199,690-925
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.42e-46
Family DnaQ-like 3'-5' exonuclease 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004371
Sequence length 1496
Comment protein Name="PYU1_T004371" Note="Similar to Rev3l: DNA polymerase zeta catalytic subunit (Mus musculus)" AED:0.177250568777341 QI:0|0.27|0.21|0.78|1|1|19|0|1496
Sequence
MAVEDATAADEELCMEVVNVDHYMAAPLPPHAIPVLPSAPCYLMAREVPVVRIFGATPAG
QKALLHIHGIFPYFYFRVENDSVFDNADELRRLLPQIALELEKANDIKQQQNANGARNSA
NRTKIVAKLLIVQGTPFYGYHPSPRLFVQIFLYNPRLVSTVVQILESGCIAERPFQTYES
HVPFLLQVFADYNIEGMNNVHMSNVKFRAPVPTKQEHLRNAPDSGQYRVILRSNTPETKI
SGVQNPSQAVPGRHVPISPIQKQWFDRHSSCALELDVAAESILNPKLFRSLQASLRESDQ
LRNVPSLAAIWEEERIRRVRNGRGSTPELSLSLKRNVDLEKSQSASVQSSSSLLSQSCFH
EKMEESLALIVKEMERDVVISDSNNNAHLEENSLMDFSGSPQVEVASARNSISTQSVFAF
SQVDANGINAGASQYQNTSIDEDEDIMNILLAMQTVDNPEWREKVSTMYSQAERLESGVG
TDLKTDEEREKDEPEGEDTGDEIGDILASQAILTNDADDTFRDSEQTGTPEKAKTPAPPS
MQDLKSTATDFAIDDIQYQPAFYSKREDIPDKAMIFGGKKFNFTPHDRAHMKPFDPDSLV
KNVSRLNQSTTKWTKFADLTRGPQRFESGQKTVRVRTPARLPPDRKVVDKWLKKEHAVVA
YTKKSRRKRPLQAVSIAPSSHNPAASATMSNVTVMSIEIYALSRRALLPDPLYDQVKAVC
YAVEAQEGPYESKTKERGVILYIPEDDAASPQAARFCIESSDIVVRSAASERELFKKVIC
LVREWDPDFLTGFEVQKASIGYLVDRAAQLDINLIQAFSRLPSTNIDARNPLSRPIQHGD
DEENGDESIGTMWGITKASGLWVHGRYILNLWRMARSEVKLSRFAFEDVLRAVLKRELPI
YSSSDLSKCEMARLFGIDFYSVLSRGSQYRVEAVMLRVTKRQNFLLVSPSRTQVAGQPPM
ECIPLVMEPHSSFYADPVLVLDFQSLYPSLVIGYNLCYSTYLGRLKDGMHPELESMVGVV
DFSPSREGILECKDDVIIVPNGTLFCPKSHRHGMLPLILDEILSTRIMVKKSMKQAKEAN
QERLEKVLNARQLALKMISNVTYGYTAAGFSGRMPCAQLADAIVQSGRCTLEAAVRMVEA
RADWNAKVVYGDTDSLFVLLKGRSKDDAFRIGQEIADAVTAANPKPVTLKLEKMYLGCVM
VSKKRYAGYKFEHPSQETGVVESKGIEIVRRDSCGVVQNAMQSSLETLFTTSDLSKVKRL
LEQYWLKLLDDKLPLKDFVFAKEVRLGTYSNGSAPPAALVATKAMACDRRAEPRYAERVP
YVVVNGSPGTRLMDLVVSPEDLVNSKANLTINYQYYIHKQIIPSLERLFLLIGADVRAWY
GDLPRSSVKARQQMYNARAARRVLGDTRSIDSFYMSKHCRLCGAIGMDTLCADCSANPQR
SLFALHVMSAQQERALQSLQLACYECGDRSSATACWNMSCSVWNRIRLVQGDKVTL
Download sequence
Identical sequences K3WHC9
PYU1_T004371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]