SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004606 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004606
Domain Number 1 Region: 225-582
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.5e-47
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 4-118
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-26
Family FHA domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004606
Sequence length 740
Comment protein Name="PYU1_T004606" Note="Similar to CG5543: Gastrulation defective protein 1 homolog (Drosophila melanogaster)" AED:0.0128526007745116 QI:0|0.33|0.25|0.75|1|1|4|0|740
Sequence
MAPFKPPKWAATPSRANRFAKLDVIKNGEVIEKVALGQQACIVLGRREDVCDYELQHPSI
SRQHAALIHDKHEQINVLDLGSSQGTFVNDREIEPEKPVVLEVGDIIRFGASTRTYVFKN
EDASADKHNKDEQGNPTEVVDDALMKQLPMSFGTTQKRSEAPSDNAAAARKKREAEIAAM
TAQMMAAPAKIHEDEQPTEPEVDSKDEGNARNDAAEEDDDEDDDDDDGGAKDDVAARYNI
PISHEVNLESHVKTISCIAVDPPGGRIATGSMDYHAKLWDFAGMARHVRPFRDIEVDEGH
PVLAMSYSPSGDRLLVATGSSQPKVLSREGVEELQFAQGDMYVMDMTNTNGHTHAVTGGA
WHPKLRDQMITSSLDGTVRIWHLGGKQTFKKLINTTVLKFKSKRGRRCGVTTCRFNLDGT
LVAGGTMDGQIQCYDPRKAYAGASLTVREAHAEGGGDLSISCIRFSPDGRLFASRSCADD
TVKVWDMRKTNLPVKVFSGMEGVFGTSNLAFNAQGTCIVAGTSVRRGQEQSGKVHFLDVH
TPGNVAPLASVDMKQDESAVCVEWHHGINQVFVGGSTGAVRVLYNPTLSTKGVLLSATKK
LKVQSNDSGARIDGLGKVHNPHSLPMYRDEESRKRKFHKIRSDPIKSKAPDRPITGPGMG
GKISGSTTFTQYFMSNHIKTSFREEDPREAILKYAKKAEEAPQFVARVEGKVDERYALAK
ETLEQEKISREEEEKRLLLH
Download sequence
Identical sequences K3WI14
PYU1_T004606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]