SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004686 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004686
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.3e-56
Family Trehalose-6-phosphate synthase, OtsA 0.00017
Further Details:      
 
Domain Number 2 Region: 274-475
Classification Level Classification E-value
Superfamily HAD-like 1e-21
Family Trehalose-phosphatase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004686
Sequence length 917
Comment protein Name="PYU1_T004686" Note="related to bi-functional a,a-trehalose-6-phosphate synthase / trehalose-6-phospate phosphatase" AED:0.109087350217865 QI:1|-1|0|1|-1|0|1|2|917
Sequence
HKGVEFNGHFARVTICPVGIDADKYTSLAHSTSVQEQITQMTAKFAGKKVILGVDQLDLT
KGLVHKLLAIDELFTVHPELSKDVVFLQIATGTQSLFESPLGSQVESLVSRINSKLQDIG
AEGPVQYLNKDIPQEALIALYALADTLVITPIRDGLNTIPFEYVVCREAHGKHARIVLSE
FSGSAHSLGGAALVNPWNTEELVDALLASLQENDDVLRAHQSMYSYVRTFTSKHWADNFL
EQLRECGEENALSVSGRELSRRDMTSAYMRSSRRLIFITYEGVLAAEASIPELSYPPQEL
IWQLSMLTKDPRNTVVLVCARSTSVCEQWFAGLTGNIVLAAEYGVYVKWVGEREPWRCMV
PNMDTTWWEHVVPLLEYYTERTPGAFIERKDSSVAWHYRDCDLDHGTWQASELLVSLREL
TRSLPVAVCPGNRFLEVRPQKASKAWLFERIWEFMNYPILFPDEDPVTTDYFGDMVKSMH
SPLMRPYGGSQPPNSNWRKDASNMTPLRLGGERDEDADGNNSAGGSDDGLTVGSENDFQP
VDFLLVIASGEDRTDEDLFAYLVPAPIDLEAYCRQLEKDQYGDVTGNQAGVEEEGPEGSS
GALRRRSLNESGADSVSSGNFDETPKRLSPKSSFRRLMGLDSTASSTPDTTLAGDVLPQP
LARHSSQGEADFLLGENITKLTPLYSNSSKQSISDDAANMFPRTLLNIPSNARRDEITER
SKFTPRRDFPPSAALYKAMKSKYGDNFGMHALPDTPAACWALVVPPNARAKLEDPAASMP
TPSGMDRKSSFGTSSTAAVVGSPGSTSTLDGTSSSVTGDSYSNHSPSASMTDGDEQMRRE
IEVLRSLDGGATHEKDGTEDQYRFPVNTFVCTLGRKLSQAPYFIKNSADLYQLLQEMGLN
SHIRKQRMMSMGSYIDE
Download sequence
Identical sequences K3WI94
PYU1_T004686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]