SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004696 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004696
Domain Number 1 Region: 99-367
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.24e-75
Family Transglutaminase core 0.000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004696
Sequence length 433
Comment protein Name="PYU1_T004696" Note="Similar to NGLY1: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase (Macaca fascicularis)" AED:0.0760368663594471 QI:2|0|0|0.5|0|0|2|1|433
Sequence
PPSPAYIKVARDLNEGVPGKFAQPIYLYYTVAPLGGFVCDSSRNHSEFGECLFLSRHYKQ
LSTIADFDADRVKAATTLAHNRRSFDDKVLHSFYQQGQHSMMSRLQSTHRSVLRYESKDM
QSEALKHIPVEVLHERARANPSPMPAYQDELVMQLLHWFKREFFSWMNQPKCSACGHSNT
TIVRTEPPSTPEEVSGEAGRVEVYRCPSCGTLARFPRYNNPVKLLETRTGRCGEWANCFT
LCCRAMGFEARYVLDFTDHVWTEVYSEHFNRWLHCDSCEDQLDCPLTYEVGWGKKLTYIF
SFSHEEIVDTAKRYTQDWEEMQSRREEVSESWLKSSIAQLNQSILSGLPSSRAHILRARA
IIEQEELDRGRSAKAGEVQGRVSGSAEWKNQRSEDGKSKAESGTTASAQTNSTGSTAAAQ
IRTAFTAARLLEI
Download sequence
Identical sequences K3WIA4
PYU1_T004696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]