SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004727 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004727
Domain Number 1 Region: 789-1419
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.96e-182
Family Molybdenum cofactor-binding domain 0.00000000000414
Further Details:      
 
Domain Number 2 Region: 254-474
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.2e-49
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000146
Further Details:      
 
Domain Number 3 Region: 659-804
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 1.44e-39
Family CO dehydrogenase molybdoprotein N-domain-like 0.00011
Further Details:      
 
Domain Number 4 Region: 116-195
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.96e-30
Family CO dehydrogenase ISP C-domain like 0.0001
Further Details:      
 
Domain Number 5 Region: 476-594
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 1.44e-27
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00026
Further Details:      
 
Domain Number 6 Region: 18-106
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.15e-21
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004727
Sequence length 1441
Comment protein Name="PYU1_T004727" Note="Similar to XDH: Xanthine dehydrogenase/oxidase (Gallus gallus)" AED:0.0239251040221914 QI:0|-1|0|1|-1|1|1|0|1441
Sequence
MAGALEYDELLPAAIRHELLLYVNGKRIAIPEKDVQPELTLLQFLRNTLNLKGTKLGCGE
GGCGACTVMVSKYDVQAKQVRHLSVNSCLAPLCAMDTCAITTVEGVGSITGQGRDAEGLH
PVQQALAESHGSQCGYCTPGFIMALYSMVKQRETGVEMTMEDIEHGMDGNLCRCTGYRPI
LDAAKSFGSDAQKAVCKGECEGCPRKGSPDIDIEDLQIDEENGGVKEVSSCSTGKIRTLA
KKFEKKMDHVKTHGDSNVFPDELQQKAIAPEYLQLNGKSVQWFAPVTLPQLLQLKQKYND
AKISVGNTEMGIETKFKNLKYIHLINVNRVPELVAIEEVTVSDSINGTVFAGADPFEGAK
FGAAVTLTDVKTYLSSRIKSLPSHQTHSFVSIVKMLKWFASTHIRNVACIGGNLVTASPI
SDMNPLLAAMNAYIELKSTTSTRFVRVRDFFLAYRKVDLAADEIITSVYVPYTKKWEFML
PFKQARRREDDISIVTAGIRVKLDCSAMSGSWIISDVSIVYGGMAPVTKAATASEQFLVG
KVFDANTFDEVFDILHGNDFNLPDGVPGGMAKYRESLCSSFLYKFFIATSKTLQEQIHSE
ALQSSAVLPAAPKIGGKIKSAGESFLHQSRSVSRGAQSFGVEKGGLLNSKHEPIEGEKAE
RTPVGDPLMHKSAYLQVSGEAVYTDDIPNMSDTLHGALVLSTCAHGIIKSIDPSEALAME
GVHEFFDASVFDTARLGSNKIGPVVKDEECFASEKVVCVGQPVGIIVADTHDLAMAASEK
VKVVYEELPSVITIQDAIREKSFILPVHTIIDGDIEKGFAESDIVLEGEVNLGGQEQFYF
ETNISLCIPQEGGLKVISSTQAATKTQVLVARVLGIDENRVTCSTKRIGGGFGGKETRSV
FVACAASVAAYTMKRPVKCLLERHVDMLTTGARHPFYAKYKVGFNRDGKIMALDLDLYNN
AGYSMDLSQAVMDRALFHCDNSYKIPNIRANGTVCRTNLATNTAFRGFGGPQGLIVAESY
IDQIARKLNLAPEVVRERNMYHRDEVTHFGQPLEDFNLRTLWQHTIDKSGFAAKKEATVV
FNAQNRWKKRGVALIPCKFGISFTSKFMNQGGALVHVYTDGSVLVSHGGVEMGQGLHTKV
IQVAARAFGIPHEKVHIEETSTNKVPNSQPSAASMSTDLYGMATLDACEQILERLQPIRE
RLGPKATFSEITNAAYFARVNMSAQGFYIVPNERCGYDFAKSVAENAAVGTAFNYFTTGV
ACTEVELDVLTGDFHMVSVDILMDLGASVNPAIDIGQIEGAFMQGFGLFALEELVWGDDG
HPWVKRGHLFTRGPGAYKIPSANDVPMDFRVWLETNQKNKFAVHSSKAVGEPPLFLGSSA
FFAVKEAIYAARKDAGIEGHFELRSPVTPERARMACGDELLQKVFTARGADMLSYQPAGS
F
Download sequence
Identical sequences K3WID5
PYU1_T004727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]