SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004746 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004746
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000305
Family Ubiquitin-related 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004746
Sequence length 129
Comment protein Name="PYU1_T004746" Note="Similar to MUB2: Membrane-anchored ubiquitin-fold protein 2 (Oryza sativa subsp. japonica)" AED:0.0512054442093033 QI:0|1|0.33|1|1|1|3|132|129
Sequence
MSSGMTSKTGSSGDDLALKFLFANQDGVNVVLKFPKSTFVSAVKADLARNWPQGVTPPED
HKSVRLICMGRGLLQDHQTLDGCKVPAFPTHPTPVNVSVLRKAPSTTRDFPQTVAAKSVA
ASGCGCVLQ
Download sequence
Identical sequences K3WIF4
PYU1_T004746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]