SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T004970 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T004970
Domain Number 1 Region: 317-582
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 1.65e-48
Family Glycosyl transferases group 1 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T004970
Sequence length 583
Comment protein Name="PYU1_T004970" Note="Similar to MJ1178: Uncharacterized glycosyltransferase MJ1178 (Methanocaldococcus jannaschii)" AED:0.228321426230583 QI:0|0|0|1|1|1|2|0|583
Sequence
MAPLSHLRQASQGASVLRIASWLLLAAWTVLEGAAGYTSSHPSDLILGDKLNRQLPSRRQ
VVDLHQHSEEERASVEQDEPAPILDNSSEPRIEITFPRNHSWWQTPPDGPALKFLHVHFA
TRSFNIPRDGYLLMTGHKLPENGFRYDGHESKFALVDLAPGSYFITLTLHRWNDHPVRPD
NVAITVLHVEVVVPQQNLHPEWRYVMQGEDRKPMAFVNLPTVADRNTKTNHNVPADVVRR
YNVTSQRHLTNIILEMFYEAFPHARSSFSSISPADYAKLHTIRAEFAVSFWQNVTKELQS
CRDGVLVLGNARSAGDTAVVLAARMAGVKATIMELANLYPEPVEVDVLLGPSHYAVAHPS
VAGVVRFKRSYVLSTGVDTDMFAPATSPSELNTWSKTGDQESRFTIGYVGRLATDKSVGI
IIATAKLMKQSCQHCHFRIIGDGPLKKHLKILVQEWHLTDFVEFLDGIYNDEPALVRQLR
TMSAYFSSGLLETLGIAALEAMSVGIPVVGFATGGASEYLSDGVNSIAVNEPTPEGFRNA
LMSLVQNSELKRKMGENARKTVLDRFSLNKCFAKYATLYQRLS
Download sequence
Identical sequences K3WJ28
PYU1_T004970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]