SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005005 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005005
Domain Number 1 Region: 142-570
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.07e-55
Family UDPGT-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005005
Sequence length 661
Comment protein Name="PYU1_T005005" Note="Similar to UGT8: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase (Homo sapiens)" AED:0.106468630668487 QI:0|0.75|0.2|0.8|0.75|0.6|5|0|661
Sequence
MSKQVHGGATTTVVDAVSAPIATASVNDWQLGVSMRSASGRLRSLDVQPFASMRIHHVQL
TRSTATKQQTTAPSSLATRLQLLWKLNSWFILAVSLLFCIARASAASSRTFSDSANDGSR
NSGMETNGSGASLFPAHSDWYIVLVSIPVMDKVLPLKHLAEELLYRGYRVGFALPENCRQ
WVSDIEHLEFISLGNIVGKGRGNYLELDELSKIGIYESYAATLRYYASFQRPMFGALLEN
LEDDRPNLVVVDRYTFAGLDACHALQIPYAVNDPHMLLDMDTPPAYIPAPFSNVSMHTTS
VWERCVNSYYRLRFRLVMVQAYKEINQVRREHGLPQIENKDQIYGQQLVLVNSAFGLDYA
RPIAPQFQMLGVLRSRKLQDSDAHLPLEYLSWLALDATAKPIVFISFQTDIPLSPDFVAT
LVDGLERVDARLVWKISLQEQSVFDIKSRSRSSLFFISDTVDEAMVLTYSPISVLITAGD
YQSIQEALVDGIPVLGIPFSAEQLEGVNSVVRAGAGILLDAHSFTERNVHFAVERLLHER
DFRACAAYVGELIRAGGGASSAADHVLSVVEFGASFLLPVKNTQPLLKTYLVDVYLIYGA
ILCGAAVILRTFVSILCAIFQAPLPSPVTPGTAATSASATATATANGASSNGTRGKMDKT
A
Download sequence
Identical sequences K3WJ63
PYU1_T005005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]