SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005056 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005056
Domain Number 1 Region: 40-319
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 2.49e-52
Family Glycosyl hydrolases family 6, cellulases 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005056
Sequence length 365
Comment protein Name="PYU1_T005056" Note="candidate cellulase; C-terminal GPI-anchor" AED:0.0450819672131147 QI:0|-1|0|1|-1|1|1|0|365
Sequence
MVRNLLPLLLLLTSPWRVDAVDKLCSLPPATYTGAKNEYSDIAFALNQLEEFGIATWYSD
RLVNGDARQTITDLVNTCDESTRLSVVVYGLPNKDCAAGYSNGNGTVVTSNDYVDFVTQL
AETVGERKVLYVLEPDAVGLIADDGCAVESGYKDNLLLAIPILARNPNAEIYLDVGFWTL
ASADSRTKVAQIVNELSRAGRLKGITLNTSNYRSTQEIATLCTDFQQTIANTTMHCIIDT
SRNFPVVAGVNSSEWCNKRSAGVGIPPSNTTGYDNLDYFVWIKPPGDSDGTCDEADRTND
SMKGPEAGVFFKNHFIKLWNQGHFVQELKMAKLKDPDDSSTAPAPLQAALFATATILATS
VWLWL
Download sequence
Identical sequences K3WJB4
PYU1_T005056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]