SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005198 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005198
Domain Number 1 Region: 456-805
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.7e-94
Family Hect, E3 ligase catalytic domain 0.000000884
Further Details:      
 
Domain Number 2 Region: 175-369
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-25
Family Fibronectin type III 0.0018
Further Details:      
 
Weak hits

Sequence:  PYU1_T005198
Domain Number - Region: 117-146
Classification Level Classification E-value
Superfamily NHL repeat 0.016
Family NHL repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005198
Sequence length 812
Comment protein Name="PYU1_T005198" Note="Similar to pub1: E3 ubiquitin-protein ligase pub1 (Schizosaccharomyces pombe)" AED:0.132436945337195 QI:0|0|0|0.5|1|1|2|0|812
Sequence
MGGGLRKPSSSSFYTVKCAFATTSGPSHSATVVPTAHDAALALDAQLDREEELQAQKEEE
RAQKQKVAVAHVVENLFPYAPVVVQTQKYPSGSPKAGQAYLWIAVDEDAIKHRGGTTNSP
VRYPVGVAVDADGNVFVSEVASGKARHGAGDPSGIHLTQTISAESIMEFAFSKQVPPVPM
PPRLVEATQISLALTWKKSTDTTVDRYEIQYRRADSPNNPWSSLAVVSSGKNVSLENVPC
HTAYLFRMRGRNPAGWSDFSSPSDVFWSLPGVPSLPNPPVAGALTNTYASIFWSRVNDHG
ALPVVYFLEMRESAGGGGGTTTFQQIYEGTECSFVAGGLRANTAYLFRLQASNVVGSTAF
VESKPIRTLAHGRPGIVELTSFEQTAAYDRWVQCWDPKTEQVFFFNKYTCQRVTEEPREV
AEAREKAGLSNVEETPEMIFRRKRFRFHRDLRQSMHGINFSTTISLELARENMLEDTFAH
FQRLSKQELVAKPKITFANEPGIDSGGLTKDWFLQVSKLALHKQRALFKLCDHNQFEIDS
NSSRNASHLQYFRFLGKFIAKAIFDRQTLDLPFCDVIHKHLLHIPIVMDDLRQMDAQFHK
SLTWMLKNSIADVIDETFSVEVEDGSSKKPVVVDLKENGRDIPVTDLNKKEYVELVLQWR
TEFGVKAQLDALNQGFHSLIPTSFVKMFDLSELRMLMNGKPMIDVEELRASTVFQGGYSE
HSQVVLWLWQALREFSLEIRGQFLKFMTGTNKIPLDGFEPPLNLTKSDLDPVALPRTHTC
FNQLVLPEYASYEVLVEKITFAIQNAEGFELS
Download sequence
Identical sequences K3WJQ6
PYU1_T005198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]