SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005207 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005207
Domain Number 1 Region: 129-225
Classification Level Classification E-value
Superfamily LCCL domain 1.12e-20
Family LCCL domain 0.0014
Further Details:      
 
Domain Number 2 Region: 481-565
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000105
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005207
Sequence length 567
Comment protein Name="PYU1_T005207" Note="Similar to YIL067C: Uncharacterized protein YIL067C (Saccharomyces cerevisiae)" AED:0.116808287742987 QI:0|0.66|0.25|1|1|1|4|0|567
Sequence
MRFARTSAATGVAPMATSGDLQEPDAESAIMSPDLSAAPTLVYMRAPREHSRASSVSSGD
DTDGNEKRATQFSRETTLLYLRANGVLILYSGVAFMLLLLMFHLSFFAAEMDDDNGAKPE
FIGCRSWAYDDSCGLNGIDCRPFESDWSAFRCPTKCNLDGSSSLAVYGSGPYRADSRICR
AAIHAGVISSNGGCGYYKFSGAATAFYGSSAHGVDSHEYLSWFPKTIEFKKGSSSYCTDL
SWGILAVAVVIFFGYALLPRTNPAMLFYALVAWGFVYVHMIAQTSSVDYTGIALRTFGEI
FVLLAASSFVFRLAPAYTFSHWNQLPIVRRVLLWGVCYVLPYHLLLHMNFIAFVPWLNFN
IGGYEGTDTNAGTYIVIACIVVIALVCAFVFLRQLYRVGIWKKYILLYFLLVSWVLISWA
LFHSTDFHLHHTMLFALIIPFTRFPTPLAAAAQSAVLGGFVQGYAAWGWSSYLETIPTYL
AIERPSSPPVAFNITTTSANISWGSLKEVDGYSLRLNSVEVYRGLDTNTTIANLEPNLTY
FLTVAGVASYGTNGRDGPEANFTTLVN
Download sequence
Identical sequences K3WJR5
PYU1_T005207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]