SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005309 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005309
Domain Number 1 Region: 13-93,141-335
Classification Level Classification E-value
Superfamily DNase I-like 1.03e-54
Family DNase I-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005309
Sequence length 559
Comment protein Name="PYU1_T005309" Note="Similar to Apex2: DNA-(apurinic or apyrimidinic site) lyase 2 (Mus musculus)" AED:0.0693793972884017 QI:0|0.5|0.28|0.85|0.83|0.85|7|0|559
Sequence
MRTTEAPTVVRPLRLLTWNVNGLRAVLQRGESRKTLRQFLDALDADVICFQETKLTRSEL
DEELVRPEGYDAFYSFCRVRSGYSGVVTFCKSDVPTLNAEEGLTGQWKTANAVGCVGELH
HEACILFELTLVFGTKLVNELESEGRCVITDHGAFVLLNLYCPATRNMERLEYKLAFHRL
VQDRVYALHAAKRRVIVVGDINIAHKEIDHCDPSPTEGIAFADHPCRKWMDEVVVGHEGS
SEKHANAARTSGGKLVDAFRYYHPHEARAYTCWNMVTAARQTNYGTRIDYILVDHTLMED
AVTDCRLLELISQQSFLWRSIQPDRLGSDHCPVLLTAVVQLPIASETTKLPALCAKNFAE
FAGKQQAIKSFFSAPTRVESPHKASTTSPSQSSPSSSSSKFASPSLKKRHSMTQTRASAS
RKLNQQSSIKSFFAQSSAVVSSSKVLPNPGRPHEKDKDVIEREEREFASVVRDFETKHNA
AQDRLRAWKQVLSGQPPKTPLCHCQQPTVLRTVLKTNDNWGRKFYVCTKPAGEKGNPDAR
CEFFQWVDDKSSKRVKTTR
Download sequence
Identical sequences K3WK17
PYU1_T005309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]