SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005384 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005384
Domain Number 1 Region: 599-862
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-73
Family Protein kinases, catalytic subunit 0.0000492
Further Details:      
 
Domain Number 2 Region: 29-152
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.000000000177
Family Cofilin-like 0.032
Further Details:      
 
Domain Number 3 Region: 169-268
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000883
Family Cofilin-like 0.026
Further Details:      
 
Domain Number 4 Region: 366-448
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000285
Family Ubiquitin-related 0.02
Further Details:      
 
Weak hits

Sequence:  PYU1_T005384
Domain Number - Region: 307-352
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0229
Family Cofilin-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005384
Sequence length 880
Comment protein Name="PYU1_T005384" Note="Similar to drkA: Probable serine/threonine-protein kinase drkA (Dictyostelium discoideum)" AED:0.189552898860504 QI:0|0.64|0.46|0.8|1|1|15|0|880
Sequence
MDATQIPHTFVRTVKAQDLCFNQVDDLLEAVKTKASPTWVILAFADPRESRNTMKPIATG
DDNLSDQSKWPSELFAPNTLCYGFARIEYDEDNTFPPSFVSFCWKGRSLPIYLRTKYTEF
NHVIRKHLGAITHVTLQSPEELIEGSILRQVPQRRPRCSSRRNISNEIEVATEVAQTVKD
IRSDSAPFNWVVCGYETLENEKSKQKLVVIEKGMSGLYALKGIGGITSVLQEGPTMYIYL
RVDIPLHRGTDRIVSKYVLVTWQGSELSPTGFNSDDEADMWNAPPLSPYSDAPPSSTSRD
SFNSTSSKIQRALTAHVLSAEISRVFPHHVHFFASSLSEITEESIRDRVRRAVDNDCMLL
RVVCIQASGDTQPPVCLEIPFDANVGVLRKEIAANIGIPENRQRIVWIRQTDEFKNEAQQ
NSKAIMLDDDEAGIRKDIGLGHGDKIHVDDKDNGENSVLAKLYDQINSGTASVSLSAERR
HEVQRGVEAREAELQKILSVTNYLLRRKASKEFRPAPPLLEIIAAANARSNNRAQIVPVA
EEAVEKVPEAPSSVSTVSLISEDLGQDVSNLEEQARVLEAQNQYLDIPYESIRILGGKEN
ELGCGKAATVYRGVWMSRNGAAEVAVKSFRYVRLTDKILGDYTQEVAMLRKLKHPNIVLF
IGACTNPKLLILTEYCSRKSLYEVIHSNNFETIPWKFKVRMMLDAARGIQYLHSKRIIHR
DIKSHNFLVDDDWRVKVADFGISKVLDNDTAFTQCGTTGWVAPEVLLDEDLGYTFKADNW
SFAIVMWEMIADGNQNPFIGMAPIKFYNQTIHSGIRPPIPEGVEPDYVSLISECWSANAD
DRPSFDHIVSCLERILLNLGASIDLPPAFQGGYHQGVLTV
Download sequence
Identical sequences K3WK92
PYU1_T005384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]