SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005456 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005456
Domain Number 1 Region: 293-478
Classification Level Classification E-value
Superfamily Bet v1-like 1.11e-31
Family STAR domain 0.00057
Further Details:      
 
Domain Number 2 Region: 68-134
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005456
Sequence length 488
Comment protein Name="PYU1_T005456" Note="Similar to STAR: Steroidogenic acute regulatory protein, mitochondrial (Mesocricetus auratus)" AED:0.00408997955010226 QI:0|-1|0|1|-1|1|1|0|488
Sequence
MCVRPQPSTSSVATSPSSPRLPTRRARGMSAIKPSRQSRTHSFSSVSTTSSNWSPSSIAP
QQDTISGHWAEDAKCRSCTKCERPFTIVNRRHHCRICGHIFCHACSRTRMVLSTNLGEIP
KRQRVCDPCAAHAQSSAISYDSDDGARMDGIGYSNASSLGPLEEVDSFEPEPTPEPSVSF
MLASMVGFAAAFWFLMDEVSYTNPAIWILLAGFCKNLHEFIASMANKRKNRKIVSQVVTP
ADVGVTVLDDAMTSGEDSAAPRQKQHDLVQLTPTQKADIVENGEKATDKIIELSLMTEGW
TSEQSTYEDVFLHSRDGKPARIYKCETEFDLSPDELFDELFGRFETSSTWNITAAQNNIL
QPLSENTDLVHLVTAPALGGMITSRDFINSRTWRKYNGGYVIGSICAGKNLLKTTKGITR
GENGATGFIILPHETSPFKSRFVWILNCDIKGYFPGSLLKKGSISEMLCFVRNLRRHLAA
AAGSDSTQ
Download sequence
Identical sequences K3WKG4
PYU1_T005456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]