SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005868 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005868
Domain Number 1 Region: 174-326
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0072
Further Details:      
 
Domain Number 2 Region: 944-1053,1257-1356
Classification Level Classification E-value
Superfamily Fibronectin type III 2.59e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 3 Region: 306-409
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-20
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 4 Region: 849-931
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000184
Family PDZ domain 0.029
Further Details:      
 
Weak hits

Sequence:  PYU1_T005868
Domain Number - Region: 521-569,638-688
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000152
Family Cell cycle control phosphatase, catalytic domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005868
Sequence length 1523
Comment protein Name="PYU1_T005868" Note="Similar to tbc1d23: TBC1 domain family member 23 (Xenopus laevis)" AED:0.05663475446658 QI:0|0|0|1|0|0|2|0|1523
Sequence
MVQTQAQHESEGTGDGADAVLRDAEEFVQELETAAVQDVDPFALLQSIEEKKNGAAKEVE
AALGSPIGASCGGSTDKRDAIEAMEKQERTNEERRTDDSSKPVALKRVSVHEPGGAATNE
KVSDDTVQEKEESDEQRVLRQELLRAKEMELFQNQLEKEMLKRRPDHFIIGVICRSLGGV
PAHMRSSVWKELLGVARSERLYLDQSILQVEEDLENQKVISADAIRTRGNDPYFKQPETV
ELVTKILTYYCKCRNIRYKQGMNEVLAPFLILERDPPMPEGIVFQCFYALIDKFLPQVFV
DREFKSLQCSFQLYRLLMLYHDPKLCHYLDQHDMTPELYVTPWFMTLFARNLQPELVFML
WDFFLLEEDPFLMHFVAYAMVAANKEDIMSAEIAMLPQVLSNITLKTRAELEAVCETALA
LSKTTPRSFERDLYSVCYGGYKESMLPYLRQLSSASSMQVYPDELVENLMQRISAKSPAY
AKLVQPPVPKADDSMNPLLSPLARGASFSTEKSLSASSVFFIVLDCRPVEQYRQCHLSLS
YHIDPEVVGSPDALSVLLKGFSRMKGCHFCFVGPAGPSPSEPKSNNIAFDTISRLARNIS
GEKKPHVEVQPPPLATTASGRLDLPTSPGFPGAGANDIISREQAGTGARKLHYEHISVTR
LVLMFLQKGFEHISRLDGGFDDLKKEILAMDAFTQEQLLVHAERANPPTSSSSGGFKLFS
KIGLTRLRSTQSDDGNSNNESEAGSSASTASSTPTQPEQSSLPPKPKPSATITSLSQRFQ
SFTSAAKDAVSQGTNSSSRLKSSPHLTSPVPVGTATDGLTDEQLVGEEEWVEVCLKTREA
LEKSLAYKEVVFQQGSMGILLQKSKNNKVFQAIVDSIVPESQASESQQMERGDLLVSING
QSMANVAFLSVIELVKDARRPVVLRFENPNKKKAMETFDAISLPPLAPTLVSATRHSIGI
AWNKLPLPNIRYHLQYAKQSEFNFNPWISVTMKHPDGSSSDLSATGITELTNGMMVGLDP
GQSFVFRVRCGNGEKWGPYSLSSNPISTLEDSTDDSSENGGAGETDSTKESRPSCDRGNA
GPVFIPGACPEIVERGLFYYRVTISLRARKRPAFDAEKLDIVLEKGAVIKCTERLVAPGT
NQIFVRISSNDTCVREDDKGVIEEDQHVNDAGSEEDDAGVWAFENTPEGAVVLERLPEYT
EDDDSAEDEPLSVTPPTSFPLPEQAKSMVSSFFSGSGTKSISSNSTVTIDANNSSNAPPP
RTVVVHVAPKILQVFPVSSTSIAVTWDPINDVGITKYQIQYSKNRLAAMWWNANQEIEAD
TLKYLVSNLMPNTPYLFRIRGCSSDAGWGPYSEASESCRTLSVEENKPSLVLPDSTSGKS
EVNDEMIEEQTPGSRTNSGNFRLPGGSIFSAPSSTPLRTGSTLLDKAVSVASRLTSRRRS
LSSSTSATSSGASAMGVGTEDEQQEDELESDHMIEDGNGITYRHNTNLRHEVKLQAANPF
LLAPVSTKWGNEMSWLHQLRSLS
Download sequence
Identical sequences K3WLM6
PYU1_T005868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]