SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T005928 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T005928
Domain Number 1 Region: 811-1060,1232-1357
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000759
Family Hermes transposase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T005928
Sequence length 1447
Comment protein Name="PYU1_T005928" Note="Similar to AGP9: Classical arabinogalactan protein 9 (Arabidopsis thaliana)" AED:0.0948640471120883 QI:0|-1|0|1|-1|1|1|0|1447
Sequence
MHVPPEVQAAIQHFQPGPGLELKPSKPSETSVIFSWGVRLESITDPGVLYWLCLGSESCR
AHPTAIRLSAGKTSKATKHLKEVHGVESDRTQLLGQRLPPLGSDQEPQPSVEARAVSVVN
RVVPELTPSSRAEPSCQLLRAVAPEPPAAEAPAAPEAPELQTPALEVEKPPPIPVPPEVK
AAIKRYTPETGFELLPPKPNESSFIFEWGVRVQLIGNSVGANQTAWICLASDECRSQMTM
ARLYGGRTSRATRHLKEAHGIASGKTSAEATNAAPPVPSTETTTPEPTPTPAVTAGTRAL
ELLGDAASIEEESVPPLPPPPSAREVAGLSAMRVFLAVKAAIDSYVPEEGFVMMPPKLSE
RSIIFYWGVRVQAIAANGAAVVAWVCLASENCRARTTAFRLSSGKTSKATKHLKETHGIA
YEYTSTDVTNEEEARAAAVDGAFNVHEEENLAEGDFMIVPSAPEVEDPRTPENLIAVKAA
IKDYTAPDTETFALKPPTAAERSVIYEWGVRVHCTLEDGSDRLAWVCLATESCRATLTCL
LLSGGKTSKATKHLRDVHGIIAEQPRLEICTADEANGANAGEEGEQGDKTHSSEHIKPRP
RPVVRLPTTRIPLAVKAAIESFVPGPGFVAKPVRKAESSIINDWGVRVETISSGEMNFGW
ICLASAKCREQRIYTHLSAGKTSKATKHLKDAHGISTETSAAAYERSEKANRKRRRCEDS
DLLRNSDLFYDDPGRIFVLLQTLRIVNSTLPYSHGEYPESLVLRDLAATATTPLPAFNAK
VAAHCMVELFASARQEIVDYVGANRLSSNVKSLSIAASIWSSSKMSKDTKILGLRLYFVN
KQWEIKSVLLGTRFVPSSSCAIESFHKWMLHVLRDFGLQPSDLLHATTHGRKHEVKWAIN
SLSLPWNWCVLDLSNGAITKACGMVNDATQSENLPMTQLIGRLAITVYQVKHEPVLSVLF
AHLCEWLGNGIGEQLLDYQTHRFVGFTAFLQRVLEHWDALETWYDDRTVQARRTRTTTHG
VTGSVPSFPLARDKDDLMQVFSMLEPITAIARKSQKLDECPTQVDLLTTLFQLRLSVLDA
TKPLRQCRIVSSSHALGAGGALPRYATPPPPANQVTYFGHTLSPLAASTRVLLRDAFHDS
FFARYTASSPSVLDDARVSWLLEMQLLLHPAYKNFGDGLLKEVVFVCNAQRGVAAAVIGS
IFDAIRTKVRQQILEMMRSVTSVQDDATVSSDPVEVDDSTSQGEEEQQQQQTSSPLHEAK
DESRSPDHSTESAQCPYEAELERWLTSGTAVLARNADNTEAESILAFWRRQRERKQFKYL
PLVARIVFSVPACTTQLERDFGVSERMLVSQRSRFANDSENSESVNGDEFHRAAAMSAFL
NRNRDFVDVTQCAVLPSTTQAADANTPTNLRVGLAHVAQRDDVLTLDAVLSACYAATGAF
NDEAYFY
Download sequence
Identical sequences K3WLT6
PYU1_T005928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]