SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006004 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006004
Domain Number 1 Region: 335-563,601-672
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.05e-58
Family Diacylglycerol kinase-like 0.01
Further Details:      
 
Domain Number 2 Region: 59-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000374
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 
Domain Number 3 Region: 128-186
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000344
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006004
Sequence length 747
Comment protein Name="PYU1_T006004" Note="Similar to DGK1: Diacylglycerol kinase 1 (Arabidopsis thaliana)" AED:0.052122753652452 QI:0|1|0|1|1|1|2|0|747
Sequence
MDSDSGLVEPTSSFVPREAMELFNRVGYSVVGVTALLFAFLFVRKFMFYLTWRSFRDGPY
ALGFHQWRPGNLAGPQWCNICESIVYGIRSYVVTCDICGMYAHAQCAATTMKYKGVAETS
SCACKTAAVRLQHSQEPQRHLWIKGNIDPMDTCSVCGLFCGSILALSGMKCAWCHIRVHE
NCFQSHAKSHRHHFLRHCDFGRHHDLILPPSAVILNETPSYSSKSQRALSSVKNAAQIAV
NKMSNIRLRRATITNANGQSPAPPPRSDSYGSPRASSDTESSSSMSSPASSSPPLSMPLI
PSLDADFLKRFDGNGTVGNSSDLPFEIMPPKDSSPLLVFINSRSGGQMGLYVLRQIRKWL
NPLQVYDLSHQTPIEPLLQFKDIPRLRILVCGGDGTVGWVLSALDEIGGPRQPPIAILPL
GTGNDLARVLGWGSGFSTRDVSDILTEIAAAHVSLLDRWQVNIDGKKRAVLNNYLGVGVD
AQVALEFHEQRERSPGLFMSQFVNKLWYSQFGAKNFLVRTCAGLPSKIELECDGKVVSLP
PGTEGVILLNINSYGGGSKLWHDDSESEDSESDSDESDTSDDDASSKYSDDGGLFNRLGP
SSPHDGLLDVVAVYGTLHLGQMQVGLSKAVRLCQAKSVKIRFHETLPIQIDGEPWQQPPC
EVNISFLQQAFMLSRTVQERDFVTRKVGEVLDWAENTRVITSTQRDVLLAEIARRVADET
DMGRGSSTSRVSLTARRDLSFIMSSAE
Download sequence
Identical sequences K3WM12
PYU1_T006004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]