SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006076 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006076
Domain Number 1 Region: 294-552
Classification Level Classification E-value
Superfamily BEACH domain 4.84e-100
Family BEACH domain 0.000000139
Further Details:      
 
Domain Number 2 Region: 682-974
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.88e-45
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 202-287
Classification Level Classification E-value
Superfamily PH domain-like 4e-18
Family PreBEACH PH-like domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006076
Sequence length 989
Comment protein Name="PYU1_T006076" Note="Similar to lvsF: BEACH domain-containing protein lvsF (Dictyostelium discoideum)" AED:0.064157632476648 QI:0|0.62|0.44|0.77|1|1|9|98|989
Sequence
MLANKSGLKSAQTRFSLLLLEDGEFFLDDFSVYRYLDPVPNAQRKVQGRMKVCTRGFFFE
PQDINLPILRFPFRDMQRMPMAELFDQSGGDCGVYLSFETKTIVEMKERGVDHPYVQKDT
SSPENGVASKYVFALLHSKIEDFLRSVQPIWELAHQKGVLNKVDEEMLLAPVLRPRLTDQ
FDSSLLVDFRERPLLTKGKLVDRIVPLLKYPGCLMLTNHRLYFQPAQVNNVGDPVLNWAY
ETIEYLYKRRHMLKQTGLEIFLKNGDSFFFSCRSRRDRDELYDMMVNQPALKRLQQTDLE
SMMLKWQKREVSNYDYLLYLNNAAGRTMNDLTQYPVFPWILTNYESSTLDLSDPSIYRDL
SKPIGALNQERLEFFQVRMAPEYMLCLQNGKFDAADRLFRSISSTWKSCLTNHADLKELI
PAFFDETFAASEWLRNGRNLDLGTTQKHTRVGDVVLPPWASNPADFVRKNREALESEYVS
AHLHEWINLIFGYKQQGEEAIQANNLFYYLSYEGSVDLETISDPVEKCSFEAQIQEFGQT
PKHLFAGPHPARSEIGKNVQIAVPEPIVSPRKRQASDASSSSSVTNGSSFHSAEDRSSIT
KDTSNPYDNVDENAGGFARKSMFGFRGRSINVPIQAQRLVGGITAQIRRRMSTEAPIRRW
GWTFSGKKIVGDAPFWAGSSPHTLHSGEITSLVLARDGRALFSTGKDKTLKISATLDGTL
RRNLSCNLALSCCDVSPDEKYVFIGSVDNCLYMYSVDIGRVIDQVTAHDDGLSAICVYDD
RVLTSSWDGSIKTWHYTSSGITSAPLSTFMECEESVVQLSVSADGSVGAAGTRNGMVYLI
DLRTNELIRTLSPSPLRQSEISGLTFCGSVSTIACMTASNELSVYHTDGNRVTSIGVKCD
GVIRCFESDGEFAIGGSSTGKLLFWKLDEPTGRELVFQISNAHPQAVSSIAVSTNGSTLV
SASVDGSIRIWRLKRKTTATRGRLPGFFN
Download sequence
Identical sequences K3WM84
PYU1_T006076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]