SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006520 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006520
Domain Number 1 Region: 34-316
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.34e-57
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 319-480
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 7.85e-23
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006520
Sequence length 531
Comment protein Name="PYU1_T006520" Note="Similar to Nt5e: 5'-nucleotidase (Mus musculus)" AED:0.534509689717251 QI:0|-1|0|1|-1|1|1|0|531
Sequence
MLNLLRPATLLVAALFATVSVQTTDAARNQTAIVDVIAFNDVYELLQDDVSGLKIGGPSR
VIPIVQDMRKRNPNSLVLFAGDTMSPSLWSFQFKGMQMIDAHNALGVDYACLGNHEFDFG
IDAFLNVSAASNFTWLNANCYEYETKALLRGTVPRAVKQLNHPEFGSIKIGFLGVMYDMK
MPGNRLYWTDPIEAAKEQVKILRETEKVDFVIALTHQEIDGDNRFSTEVTGVDIIYGGHE
HRAMLQTNFGTPYLKADLDFRTVWSSRLEYFAADTAQNLAATTRMTHRLIPITEEMPSDT
QLDAVISTYAQRISELQSRQVGSLCNSLDLRGVSVRTMDTAVGNIFADSALHFYGQNFAD
VALINGGLIRSDTIYSSGPITLAQLIAWSPFGNTYVVFESDGASMKKFIEHEMKASCGSG
FINSNGFYVQAGGIKYVFQCNGANNGALASIEWFNHPTRTGPVLDTDVFKLTVTNYVQTN
EYLAVPGLTVTTSYVNEAEAGRVDSALEQFMLAQPNATLCYTAQGRSTVLL
Download sequence
Identical sequences K3WNH8
PYU1_T006520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]