SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T006601 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T006601
Domain Number 1 Region: 32-333
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.16e-92
Family CoA transferase alpha subunit-like 0.000000159
Further Details:      
 
Domain Number 2 Region: 287-502
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.72e-71
Family CoA transferase beta subunit-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T006601
Sequence length 503
Comment protein Name="PYU1_T006601" Note="Similar to oxct1: Probable succinyl-CoA:3-ketoacid-coenzyme A transferase, mitochondrial (Dictyostelium discoideum)" AED:0.111283643892339 QI:0|0.42|0.25|0.5|1|1|8|0|503
Sequence
MLMLRRSSVRLTVRAEKRWIGQEVSRRWSHHKVYPDADAAVKDIPTGSKLIVGGFGLCGI
PENSIQALVKQGAKELTCVSNNAGVDDFGLGLLLQTRQIKRMISSYVGENALFEKLYLTG
ELEVELTPQGTLAERIRAGGSGIPAFFTPTAYGTVIQEGGFAIKLNPDGTTNIPSPPREV
RQFNGRNYVMEEGITGDYALVKAWKGDKDGNLVFRGTTRNFNVDAAKAGKITIAEVEELV
EPGEIHPDEIHVPSVFVQRIFKSKNLEKRIERLTLSNSSTSQARVSPDRERIIKRAAKEL
KNGMYVNLGIGLPTLASNYIPEGVKVVLQSENGLLGMGPYPKEGEQDPDLINAGKETVTY
LPGSSTFSSSDSFAMIRGGHIQLTILGALQVAANGDLANWIIPGKMVKGMGGAMDLVGSG
NRVVVTMEHNAKGNGMKILNKCSLPLTGKGVVNTIITELGVFDVVPGKGLVLVEIASTTT
VEEVRSRTEAPFEVSPDLKTMDD
Download sequence
Identical sequences K3WNQ9
PYU1_T006601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]