SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007331 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007331
Domain Number 1 Region: 71-276,314-344
Classification Level Classification E-value
Superfamily DNase I-like 1.32e-27
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007331
Sequence length 353
Comment protein Name="PYU1_T007331" Note="Similar to FRA3: Type II inositol-1,4,5-trisphosphate 5-phosphatase FRA3 (Arabidopsis thaliana)" AED:0.241184492499513 QI:0|-1|0|1|-1|0|1|0|353
Sequence
MLQTSSFELGDSSTSIRSSTETGSSSSSTFSAAALELVRASSNPSKKRTRRSRGHEVRGR
GDGAFLRSKSTSIAIYVAAHLTSIIEVVRTGAHKFSFTSGSKGGLGVMLRVAGDQTITFV
NCHLEANRPARRHQQLDILTRKLPKAMGMDSSKLDLAACSDHVVWMGDFNYRVHSLDGDT
VLKLLGTHRHMELHDRYDSMKDDMETVPGMRPFKEAAKWPSFYPTYKKVPHRSPLVSTED
PSWPLHVYRVRYKEPFYKGGKVKARVPGWCDRILHCSSPASRTYLNVEKLPCAMASGTKK
ERHCTDTESNKDSRIVLRENYRSVNDALRGSDHSPVFCTFLLSVDLSPGRVLR
Download sequence
Identical sequences K3WQT9
PYU1_T007331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]