SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007349 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007349
Domain Number 1 Region: 2-252
Classification Level Classification E-value
Superfamily DNase I-like 3.89e-22
Family DNase I-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007349
Sequence length 369
Comment protein Name="PYU1_T007349" Note="Similar to BLLF1: Envelope glycoprotein GP340/GP220 (Epstein-Barr virus (strain B95-8))" AED:0.381081081081081 QI:0|0|0|0.33|1|1|3|0|369
Sequence
MMSLNVRTSNAGDKGNGNWDVRKAHMKSMLENHQPDFVGTQEASSSQYEYLKQIDGYSAI
GDCSANERTFILFNQNNWELIENGDFALSDSPELGSNTWGLEYNREATWGRFRHKASGNT
ACVFNTHYDMSKGHPKSSVLVASKMAALCKEGDLALLTGDFNTELNSGALQYLMGKTQLE
GKTNSFPMVSALDEAGETGGTFIGNGIFNTGISKTRFDFVFAKAENLCIQKGEVIDERFN
GNNGISDHAQVMSTLCIGDGCSGCAGGSSYGYDQAKNDEDDEEDDSKTEETPAPETAAPT
PEVTPEPTTEEPEPATTTPEPIPTEPIQLTPVVTPAATEPRSVNDETVASANSPTPSPTK
PKRSDCAAK
Download sequence
Identical sequences K3WQV7
PYU1_T007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]