SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007483 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007483
Domain Number 1 Region: 487-635
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000000000398
Family STAR domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007483
Sequence length 647
Comment protein Name="PYU1_T007483" Note="Similar to trfA: General transcriptional corepressor trfA (Dictyostelium discoideum)" AED:0.00230414746543772 QI:0|1|0|1|1|1|2|0|647
Sequence
MDGRNPYGMPPGGRNVPSSIPNGMQGQRPGMMPQHYGNEMLFDPMSMPMNNGMYHPQHAS
HGHPHGGYHPHAYSGHRGMPTHMGGVHHPGMMSPEEDPRFVDDIVSALGPGDLNDPVGMG
GQQHMEQIPMQVYDQTHIIPQHSQHQVRSQQPPMNHTPPQQQGPLQAPILAPPRMNSRQM
QQQSMPQQMQHMQPPQTQMQQPNSLQNVSRMQNSQPQQQSMVPPSSSAMNNISGGAIARR
PQQPPPSQSVVSSSMMPPPTALVPANSTSFSSKQSTSSVDSRALANGSNNGSSDDELGDD
DNSKKKERRRQQVRYASRRRRKKQKDEESFLRDRIEELKEQIRIIGGDLSEQCSQMAGMS
EQALTEAYEKQMQTVQTLRKDNNKLKEQLLQHENFACMIQYGLNALPSDCRDVDRKKIAG
VPMWFSDQMNPLKGPTLVVDLNLCHEAVRQAYNELKTFGPSVHSKTNVCYAMGWKTELWA
TGTCLSFKAVRAISDKNIREVANSSWDIITSPDKCKRIYPDVKQFRILQKVTDDIVVVHR
IASVASDLSDREFISVAFRVRDEYNYYIGIKSITVQTECAENCIRGDECQGWMFTGSEDE
TAQWKAHFLGYYDVKGEKDDKVLNQLANEAMFGMLRWESEAMHPLSV
Download sequence
Identical sequences K3WR89
PYU1_T007483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]