SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008085 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008085
Domain Number 1 Region: 461-609
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000189
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 2 Region: 708-741
Classification Level Classification E-value
Superfamily PA domain 0.0000012
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008085
Sequence length 800
Comment protein Name="PYU1_T008085" Note="Similar to Fndc3a: Fibronectin type-III domain-containing protein 3a (Mus musculus)" AED:0.115159159615469 QI:2|0|0|1|1|0.66|3|1|800
Sequence
PFARDPELDQSLSALLRQPVDTQFSPLDVQLQRASAKCRELGIHTLVLSKQTETSAEDEN
GDDERRGHAAYCRKVRYVRQLRERHRRTHRELHDLDQQQQEQEGEEEASETIQRTRDIVT
RDVSDVDLQEFFEKYAETSQPVVLTPPSPPAAAGTLEGPPSSESLGFVSEEELTAFKEAC
FDLRATKRAPLQLRNAKCRDLLGRFRVPVFVAHNYVHRTNVSLAETFLPALVRVSANANE
IVSCPFGLHMLAITLLKGTTVVNVFDQRFEPLFPHSRGSDVEEIEVSATSGGLFGRSTVE
STSGDLRNKLSPEYHIGTLLPAHSVLFVPGSKLATMRAAGMAASDQRFLQFCFVDASNFN
AVKQELSTEALVNGEAHTLLLSLLSPAFDRSMPRRVQPSDLLWPNYITWPKETKFLKKSD
LMNSEGGNEQLQLSRRERLKQWQDDKRWERRIETLTLPVSLPPVVVNITRTTAALRWQDL
ELDAAANSMNITRKHIVRSALPTTLFGDDFDGHDIEGVASGLAAETKYTFSVQIFVDDTL
GLESFGSRVAQTSPCSEPSGIRGVPKASDLDTTCAKLQWLDPIDDGGKPVGLYLISMRQV
QDSVDALDLITSYGPEVVVLALSTSIPIRENEASASARGVRLVLSDVNEKVVFQKFGEDE
KDDNAEMGSEVSFDVWSAHYSPRAFHVSAEIVRADPLDASTPLRNADQVRDRIVFVSRGG
VPFVFKAHYAQLAGALGVIIADVNNTCHGRFDQRCVPGGDKSRGEGFAAQDRHVLWEQNR
IPCVLALHEASQQLLELVTP
Download sequence
Identical sequences K3WSZ1
PYU1_T008085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]