SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008410 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008410
Domain Number 1 Region: 22-226
Classification Level Classification E-value
Superfamily Bet v1-like 5.56e-34
Family STAR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008410
Sequence length 228
Comment protein Name="PYU1_T008410" Note="Similar to PA1579: Uncharacterized protein PA1579 (Pseudomonas aeruginosa)" AED:0.363798572561459 QI:0|-1|0|1|-1|1|1|0|228
Sequence
MKASNPAKVYKSVEDVDFHAFGEDSVQILLDRQSGQDKLTTWNLVDSQAKGGVKIWKGQV
QGSSWSPFKVSRHINADKATIQHALIDPDLLLKMDDMTSSVRILKSVDEEGKLTLRQLAT
RAIFPVSAREFVIVTYATTLPDGRMIIASRSLPLEGVQLTDGAVRGITVISGYIIEEVKS
ASGKPCCDVTLLAHADLAGYIPSKIVNLLGTSTTVKILANLQTVVERM
Download sequence
Identical sequences K3WTW4
PYU1_T008410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]