SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008438 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008438
Domain Number 1 Region: 165-314
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.78e-19
Family Canonical RBD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008438
Sequence length 340
Comment protein Name="PYU1_T008438" Note="Similar to SPBC365.04c: Uncharacterized RNA-binding protein C365.04c (Schizosaccharomyces pombe)" AED:0.1158357771261 QI:0|-1|0|1|-1|1|1|0|340
Sequence
MTTEDAKPMNAKERRKLQREQERLEAEADATAAKKANGKQDEAPDVTTSAPVDTTQLNAK
QRRQLAREAERIAKEKADAAAVLAPAASKEDSAAAITAPVAAEKLNAKQRRLLARKLAQP
EGEVTEKQPPKKNTGDESKKRKRSSKAKEGAEEDPNKKVKSIHLTLFIGQLPYNATEQKI
REHFREAGEIEVRMLTDKRTKKFKGTAFIEVKDSKALGAALSRHHTLMNGRRINVEMTAS
GGGNKSEQRRTKIDLLRKKQSNVQVEKTKALIQKHIDSPEYKITKDDVDERMIDFLSWFD
YETAKKALEEYNRCVGDRVQNRKAFFMGILKRFRETDGVE
Download sequence
Identical sequences K3WTZ2
PYU1_T008438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]