SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008484 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008484
Domain Number 1 Region: 39-75,110-313,392-473
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-96
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008484
Sequence length 676
Comment protein Name="PYU1_T008484" Note="Similar to Usp47: Ubiquitin carboxyl-terminal hydrolase 47 (Mus musculus)" AED:0.118343195266272 QI:0|-1|0|1|-1|0|1|0|676
Sequence
MYTEEPGYAHLYDSPVEEGPANKPSASSSYSSRSVSTKNAYTGLSNQGATCYMNSLLQTM
YMTPEFRKGLYQWQFGQKTKKTKQSEESDSAAPDNDATDGDNDDDEEVGDDEPEEYNIPF
QLQKLFAKLQMSSHESISTKALTKSFGWTGADVFQQHDVQELCRVLFDAIEKSFKGTVNE
TLVNDLYQGSLKDYVQCHTCGHESSRIDNFLDLSLVIRPFGSEEMMKSVEEAIELFLRPE
LLNNENQWMCDQCKTKRDAIKGLKFSKLPYLLSLQLKRFDFDYATMNRIKLHNQVSFPKF
LDMNSYVSDESGARGRGKIARKMSMERHELEAKAHKSDRMRRLSSMDESQPLQFADEDDE
QDEGRRDSMTAPTEFDTWSATFDPQDMIRRNGPHVYELYSVLIHSGSALGGHYYAYIKSL
ETGKWFNFNDSHVSEISDDELKTAWGGTGGNGYGSRMSYSTCAYMLMYRLVSEEKNINSI
PKESIPAYLTQKMKADEDRLKQLEHERLEMTKKVLIRFFMKGSKPKNMEKSIHVYKTSTV
REALTIACEAFAKEKDIVIPSPENVRLRGYNDYNCLLSDTYDGKEDATLTSLGIYAAQQL
FIEVKSDDEEWEPYDPFKLQLFMRRFVGNEGGDENNNSDNDNSSTPEIAAGDANKLKPSL
MARCIQVDDNATLGSL
Download sequence
Identical sequences K3WU38
PYU1_T008484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]