SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008487 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008487
Domain Number 1 Region: 68-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.04e-18
Family Ubiquitin-related 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008487
Sequence length 323
Comment protein Name="PYU1_T008487" Note="Similar to Nedd8: NEDD8 (Drosophila melanogaster)" AED:0.217587672688629 QI:0|1|0.83|1|1|1|6|91|323
Sequence
HTQSDPHPVAQRKEVDETQESTTARARRTYTERERESSTMMEPESTSEEKPLLSHDVGIT
IADDDGDQEQQQQNEKIVVKVKTLSEKPIRIEIHPSASIGELKEIVKKQASAEGKFLRLI
HQGKMLSDDKATLNSCKVKSEDFIHCAISAAPPKAIVNQMAAESEEAEREDTSRRGFDRL
RDRLSREEIQALRLYFYPQLSLYISQAERIPGESSEDRIYRLEEEWMDAQGPQSEFSLNV
VPTARIAMDHQIDMTGMNNSILAADNEGTGTEFLWGFLMGLLLGVFMLLMLLDRSVPRKQ
KVGLLLGVSMNFFLSVVPKAVSD
Download sequence
Identical sequences K3WU41
PYU1_T008487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]