SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008538 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008538
Domain Number 1 Region: 1443-1591,2369-2551
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.69e-60
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0015
Further Details:      
 
Domain Number 2 Region: 511-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000156
Family Pentraxin (pentaxin) 0.045
Further Details:      
 
Domain Number 3 Region: 1137-1163
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000314
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 
Weak hits

Sequence:  PYU1_T008538
Domain Number - Region: 1206-1233
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00068
Family Ran binding protein zinc finger-like 0.0052
Further Details:      
 
Domain Number - Region: 383-406
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00392
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Domain Number - Region: 1084-1106
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0254
Family Ran binding protein zinc finger-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008538
Sequence length 2676
Comment protein Name="PYU1_T008538" Note="Similar to Usp38: Ubiquitin carboxyl-terminal hydrolase 38 (Mus musculus)" AED:0.0315892908581965 QI:0|1|0.5|1|1|1|2|79|2676
Sequence
MEAAMPHLRTLLSAVVAHSGAYEASKNGQVPVDAGGDVSLAHALGAVDADAAQFTDVDRI
FWDSLSQEHAQDLMNDIGLLLASTTVKDVKLVHLMKVLLLDPLFDSVGVLQLVQKTFHGL
KFAKRWDALILASNECIDAVYGKIYEAETSQLALQFWMEMLLGYQHAADLYQRNHARLAD
VAAFLGVQREKHAGDVDLAQQYQGMIAHFVLACVALMHCHRGYEQESYLLQLAMKQAFRE
EDLARPTAVAAETLLRESAWILPAETVGKYLPSIEGKWVLDEFSSDHQHAGASAPQNAGS
VLLRKKANCFAHEITATIEGNDESQKFRLSGYVFQEIPEMQVLLSQPETIVTSPWELEGH
WSQLYEANAATNSRPSAPVLPLPWNCHACTMSNEASATKCSTCGTKAPAKVTIQTSFDSS
LGSNPAPFGATFDSSYSFMRMQWTRGEQRGVWLAKKQPLSRQFDFAPIFATAGNTMTDSS
YLPMHVYSPMGKADNVLLLEKPIVSTGSNMEITLQVWIRPDIPHEESQRQAILSYGAEYA
LWMTSSGELVWEIVGGLCSVTSSKLVNFETFSHVTLLLGKHKMEMLIDGASVGDAEYGDD
VRGNIFSARAPVFAIGGDLIAGVAPEIQSIFSGAVIDLRIWSALLVTPSSLTTALSGEEE
HLIGYYPLVGDSQRILMDLSKQENHATVFEAFSPSDAIGREKQVSVVGNNFSPSVQVEEL
PVMLHFPTSFDSDFIGSGRFSLVDGVGALVIDRSGQGGALWNSSPVSVSCGFETSFEFAL
ANAAGTSGDSRCAIFTLCESSYWNVSPLVAEASTLFEAPSASLLSISPASSSCFNRSALF
VSIEAVPDGNGLFHHSIGLFVRSKKRNYALGRARQVATSTTSSLARVRYQVPQKVLSVEL
GEYGVVFECAVDIELALGAKSTSSIRSGLIFPAASSRPQASANTSIQLTQWYFSEQPHSE
AAVDTAQSVLASVYPGVGSLQSPNKSGENAAETQGNTVICTRCSTDGSAIEQETFGCQTC
GLIHGNTLCRICASVCHEGHELVAMGVMSAACACHIRGSGLCRCSSPVSADDFPQLQHPI
VAPLWCCSKCTVINSVDLNECSVCGNKAPRNTSSVSANKPSTSTALALVEAPQPVPSVDW
SCKACTMLNAPGATKCSICDTPRPKFAEPAGEADKSKDNNGLITLYYAAEDAAKKSQPGT
RSSTPRSQSWFCSACTMENKGTDDTCYMCSTMRTVPIVDPVESSEVILALPPSKTDPLHL
SGPIDLSKDATGEASTAPAVASPVAPSTKTENLKFLHGYKRTVAEASSQSECIIAMQGST
WETTAGKMELSFGGSYIAEYIVGAYADKDGQLSGIATINDDGVWKLEGKYKKLTQSQGNA
FILHWDQFATRFDGKWYRGDGSGDWKCVASPNTSEFRGLTTVEDSKQLNHLQPYYSGMIN
MKQNLTNVCYQNSFLQTLFMTQDFRRLILASQLERYTSVPSDGAPSAGGNNILGCVQNLF
ARMVASQRPSLDSHALQRCLGATFQAGRQQDTSDFAHYLIDSLSEQLSQQHDTVDGISNV
FGGVQATVLACKTCGKKSVNKEYFWELLLNMIDLRYTPITSITAVSGSSTDISTPTGYER
LNNDLNKDRDGAPYAFLCVKRCPERKSTTAMNVDDTSLLPITDLVVKVAPSLDVKPTMVG
YERVELDLNAGGSANVVGGKKQVYLFTRREPNGSPITDLQVIYGNESVPDGFKQIRVDLN
QGEGMKVFLCYRCDMPITDLKIVNSGIPGYKMVDHLLNLSHDDSVKQYLAYQVGGNEPCL
TDLKLVEGDDVSLYQDQGWTSIGSPSSVSVGEADPVEEDETPPVVPSQLMVRRGHGNPIF
AIDVFRAPRQVPKYNDYEVIDLYPSENADDIPSLMKGDWMANEDTDRSRKAVRIHSASDP
IAETLVVKGSFEDKGEIFAVANVTTTWAQSLSQDAGTSSEAKQVYHVTGYWKGPKVKQSQ
LFDVELRPDAVSNLYAINGTIGDGKGRPVPLYGIQTSQTVKVKWPISELMVLRGDEKVPE
GVKIVRDTCSGKSGNLLAQTQSPHSLYLAVKREETPASGSYISDISVIYGEIDAIPEGYT
CIQTTPGGFSANVNDGTSGVPIFICYRRAFGTPDEKVLMDVFPMWTSGPQVDALPVGFTK
IQHTPLGMDANLNQGTNGVAIHLCYAKSDPAHVVKPVDNPLNGEYEITSSSPAGFGKFIG
LSVLERVADARVVEGKFGTILHGYLPGSLRGIIFKSEQRQKQVMIGVCSTETQGNPTTMT
DFMVASYPFELVMNDNGDEMEGWWSTLDETPASGPTVSPVASNSSAASSTNAGGVWKLMK
DSYVRVAFKKDYGTEWKDGRLISSERVWRHDIASMLSRFVATRTLGGDNLLSCSQCEKKT
ESRTHTVIVSPPAHLILTLKRMFYDWTQQKTRKSLHDVGFPALLTLPSLTEEDEEAVFDE
SEENMKDKHRSRHYGLYGVLIHSGLTANSGHYYSFCRESDDIAQQLHLEDSPASPWIKFN
DMKVERSNWKEINRLVANSVSDAVYLLLYKKLSYPIPDVVNAHEESLESPRSGGDDEEAM
LLAKAMALSMSAASQKGLANQEAEEESKASETEQHAPRAYIDVSILKEVERENTVFMKDT
LGATSSALHADDLHTLLVLRHSFPLHLRAILDQVQT
Download sequence
Identical sequences K3WU91
PYU1_T008538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]