SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008562 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008562
Domain Number 1 Region: 56-162,206-587
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.83e-81
Family Trehalose-6-phosphate synthase, OtsA 0.0000799
Further Details:      
 
Domain Number 2 Region: 634-650,698-924
Classification Level Classification E-value
Superfamily HAD-like 3.7e-24
Family Trehalose-phosphatase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008562
Sequence length 1057
Comment protein Name="PYU1_T008562" Note="related to bifunctional a,a-trehalose-6-phosphate synthases / trehalose-6-phospate phosphatases" AED:0.115138608000246 QI:0|0.4|0|0.5|1|1|6|0|1057
Sequence
MKPQRRTTSSLQINALASGAPQAAASPHLMQRPTSPCFLAPQPLESPMTSRKPKTVLIVV
NVLPLVFARNAAGTAWVVEWSSSATSMFYRNLVSETDKYSPLFIGCPEVFVAKSEEAVVE
KQLRAFHCAPVFLDPTVAHRYFQGFCKGVLWPVFHNVVDVYNSAKLTLDEYVVDCEESAG
GDKNKERRESSGTNCWRDPASWNPAAQDKCWSDYCSVNRTFAKRIIESYHDGNLIWIHDF
HFLMLPSYLLRKVRTALVAIYLHAPFPSSEIFRCLAVRTEILRAILCADHIGFLIFEHAR
HFLTSCKRLLGLNYTTSQNGMLVIEYNGRKINISCSHIEPDVSHLHDILEHVDGDEDALS
FKKKIEKHIYDGDNKRKFVIASVDRLEGLTALPLKLRAFDRFLSLHSDKRKSVVLVQIGL
SLDSRPNDYHQTREYVLKFAAEINRRWAPPGELVVYFEEKVKTTCMERMNLWSLSDTYLD
TCVRSGLSLLPFEYIVAQKHKKEHMPDSSWPFGSMVVSEFASYSRILNGCLLVNPWKTDD
IVNALVKATEMNYYERHNRFQLNYKFLVMHSEQKWAERLLSDVESAVCKKQATEARETID
VGFGFDYRVMQFETGFVQLDLDDLVKKCTKSCRRLFVFDYGGTLSWTTSILDEDGAASCH
RNGSVDGVMACSDLGDRKTAFGQSVIRYIDGQVRTPLSDEARDNIRTLCNDPLNIVFVSS
TGRRAELDAEFASIENLNLISDNGFFLKKAGSTQWECLYKGVDLNLDWKDEVKRIMQSFA
ARTNGAYLIVNEVSLIYDYRSCDPEYGEIQSLELYEQLRQVLKKGDATVYRGKGFVEVHQ
FGVNKATAMTLVLSYMKEKVGVPDFVFFAGDDESDELAFKVLLTFAEHESALEHMFTCTV
GMKPSCAKFYVDSVSDILAAVHAIAVRLRLESSRPTLFSKQSYFDQFVAQGPLVSPRFIR
SLSVETDGTELLDALVPPTASEHSIDTFAFPQPPTPTTSAPTPVGPLTSLTSLVPSCLAP
HISSEWVILGAAVGIGCAIGASAISVHEKLRRFKLLS
Download sequence
Identical sequences K3WUB5
PYU1_T008562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]