SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008723 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008723
Domain Number 1 Region: 230-401,449-465,505-515
Classification Level Classification E-value
Superfamily DNase I-like 2.62e-25
Family DNase I-like 0.0059
Further Details:      
 
Domain Number 2 Region: 83-154
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.89e-17
Family ComEA-like 0.0025
Further Details:      
 
Domain Number 3 Region: 2-52
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 5.36e-16
Family PsbU-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008723
Sequence length 519
Comment protein Name="PYU1_T008723" Note="Similar to EEPD1: Endonuclease/exonuclease/phosphatase family domain-containing protein 1 (Bos taurus)" AED:0.0417543681258156 QI:0|0.5|0|1|1|1|3|0|519
Sequence
MLDLNTASLRELLRLPGIGAVTANHIVEARPFTSIEELLAVKGIGPKRYAGLTAAPGCQV
SINGSSKQNPETDISTVRSPRGAAGAASQPLLVDINEASEEELRQLPGIGPVIAMRITNA
RPFFRKEDLLAVKGIGTATYHKLHSQVIVADGGSSSRRSSGSGSSRSNAAEHSASAESDN
DAESERYSDLQISPDMRSSVRSLRICREVDSNVRASLFSGTPHSKPKPEAILVASWNIRN
ISRQKDTFSLTRIAEIIHEFDLVALQEVRDTVVLKKLKTMLPGWDYVVSAAVGAMTSKMT
TRTEHFAFLYRRAMFRVTDKCSLFVDEDNVFVRSPFLAHFVVVKPSGVPQVELTLVNVHV
SCGEKHDRQRELLEIQQLADDIHAQRSVVVLGDFNLAQQDMLGRADSPMTPLVRAPLSTT
VFGKMYDNIWMNVSDLLKQQQCNEIESGVYRIDWRYYPQSKPSFWSSAQHQRQWSRRRGS
GVTPLSASPTTPPRLQAYMARVQCAYELSDHCPVWFALA
Download sequence
Identical sequences K3WUS6
PYU1_T008723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]