SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008796 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008796
Domain Number 1 Region: 285-347
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000652
Family PA3566-like 0.033
Further Details:      
 
Domain Number 2 Region: 394-498
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000769
Family Atu1531-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008796
Sequence length 510
Comment protein Name="PYU1_T008796" Note="Protein of unknown function" AED:1 QI:0|-1|0|0|-1|1|1|0|510
Sequence
MHPVGECSWLGLTVNCLPAIDLESPWNYLLAHWLLAGVLFTIGCVNALAINFKGNYLMTA
STTGYVWITAAFAIFRAQYGIGKPLLIGAAMHNWFEWVFVACITRATFASKKAMITKTSM
WITFIILLVAIIPDTKIAVLVEQSVGIMLDFFLVMSYFEQAVLGQDAEVRSFYLTPFISA
AVHLFFTILPLVFANFVVGASTTFVVLNEFMIYISPVITHGIYYVWGQEFDRRCNNKGDM
EQRFMVKGATFKMAAAFGMGLIPLVGIGLHSGSCQAPTVLTGTTVARVHPGLGNAFIDRI
TQFKLVETAKKTPGCVDYVLTQNIRNTDEFRFIEKWETIEAVTAWVEKGLPSQLFHNDAI
MTQLLVGGKLQVQGAYTDVAKPKEILNGGVAFTMGSPCSKVWGVVGDWNNCSWVVGCKHA
HMVNTTTRTLHFANNRQLVETLDELYNEDMTFTSTVPGLSGSVMLYSNATSGGCDAMYSF
RTDGKTHKVNDVYRDFMNNRIPKLQSMFSV
Download sequence
Identical sequences K3WUZ9
PYU1_T008796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]